KEGG   Deinococcus deserti: Deide_3p00130Help
Entry
Deide_3p00130     CDS       T00880                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ddr  Deinococcus deserti
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ddr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Deide_3p00130 (rbsK)
Enzymes [BR:ddr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Deide_3p00130 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p3:15999..16946
Genome map
AA seq 315 aa AA seqDB search
MFLRRSLSEAQLCLVERRMILVAGSINIDFAVQVQALPAPGETVMGSAYLVSPGGKGANQ
AVACARAGAPVQFVGCAGSDAYGDQLREALQSDGIDTTSLRRVDGQTGAAFVTVGSDGEN
TIAVASGVNQALREADLPELNGVTHLILQLEIPLETVRAFAQAARRAGVHVTLNAAPAHP
LDDELLGLVDLLIVNAGELEALCGAQAGAGLEYQLEVLSGRGPKAIVVTLGADGAAFWTN
GRCHRSAAFAVQAVDTTGAGDTFVGVLVAALRHMDLTAAVQRASAAAALACTQRGAQISM
PRLSAIERLLASTVR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttgcgccgctcgctgtctgaagcccagctgtgcctggtggagcgccgcatgatc
ctggttgccggcagcatcaatatcgactttgccgtgcaggtccaggcgctgcccgctcca
ggtgagacggtgatgggcagcgcctacctggtgagtcccggcggcaagggggccaatcag
gcggtggcctgtgcgcgcgccggcgccccggtgcagtttgtgggctgcgccggatccgac
gcatatggcgaccagcttcgcgaggccctccagtctgacgggatcgataccacctccctg
cgccgtgtcgacggtcagaccggcgcggcattcgttacggtcgggagcgacggtgaaaac
accattgccgtggcgagcggcgtgaaccaggccctgcgggaggctgacctgcctgagctc
aacggcgtgacgcacctgatcttgcagctggaaattcctttggaaacggtccgcgccttt
gctcaggcagcccgccgcgcaggtgtacatgtcaccctgaacgcagccccggcacatccc
ttggatgatgagctgctagggctggtggaccttctgatcgtcaatgccggtgagctggaa
gccctgtgtggtgcccaggctggcgccggtctggagtaccagcttgaagtgctgtccggc
cgtggaccgaaagcgattgtggtgaccttaggagcggacggcgccgccttctggaccaat
gggcgctgccaccgaagtgccgcatttgccgtacaggcagtggacacgaccggagccggc
gacaccttcgtgggtgtgctggtcgcagcgctgcgtcatatggacctgaccgctgcggtg
cagcgcgcttcagccgcggccgcactggcctgcacccagcgtggcgcccagatcagcatg
ccccggttgtccgctatcgagcggcttctcgcttccactgtgcgctga

DBGET integrated database retrieval system