KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_0068Help
Entry
Ddes_0068         CDS       T00837                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Ddes_0068
Enzymes [BR:dds01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Ddes_0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(88910..89551)
Genome map
AA seq 213 aa AA seqDB search
MTAPGHCPDKASLSASAGELTPHMVENLRSVCRDAWRQGLLSGCNGNASLRLPTPHSDTV
CLTRSGAAKGRLTAEDCCLVSLADGATLHGGPASTESGMHLAVYRALPDCAAILHTHPRR
LLALSLRLGGTMEDFLNLPLFEAEVWRARLGVAPALPPGTPELAQAVAEAARTSPAVWMA
GHGLCSTGASLAEALCLTEELEHLAAIQLLSMP
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacccggacactgcccggacaaggcctctctttctgcttcagccggggagctg
acgccgcatatggtagaaaacctgcgctccgtctgccgcgacgcatggcggcaggggctg
ctttccggctgtaacggcaacgccagcctgcgcctgcccacgccccatagcgatacggtg
tgcctcactcgatctggagcggccaaggggcggctcacagcagaggattgctgtcttgtc
agccttgccgacggcgcaaccctgcacggcggcccggcttccaccgaatcgggcatgcat
ctggccgtttaccgcgccctgccggactgcgccgccatactgcacacacacccccgccgt
ctgctggccctgagcctgcgccttggcggcactatggaagattttttgaacctgcccctt
tttgaagccgaagtatggcgcgcccgtctgggtgttgctccggccctgccccccggcaca
ccagaactggcccaggcggtggccgaagccgcccgcaccagccccgccgtatggatggcc
gggcatggcctgtgcagtacaggggcaagcctggccgaagccctgtgcctgaccgaagaa
ctggagcaccttgccgccatacagcttttgagtatgccgtaa

DBGET integrated database retrieval system