KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_0074Help
Entry
Ddes_0074         CDS       T00837                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dds00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
96075..96959
Genome map
AA seq 294 aa AA seqDB search
MQHFLASEYSPVLPEQAGFHIIPVPLEQSVSYGAGTAGGPAALLEASQQLEAWECGHAPG
ETGFYTAPPVDCGGPVEKVLDRIEAATARAISCAALPVLLGGEHTVTLGALRALAKEAQR
SREPFGIVQFDAHADLRSSYEGSPYSHACVMHRAVADLGLPLVQFAVRDFCREEAEVRKA
HNVTHYDAYFMARVGLPEQPLPEDFPRRIYITFDVDAFDASLMPATGTPSPGGISWREAH
FILERCVAGRRVIGLDVVELAPIQGLHHCNFTAAKLTHLLMGLAHAANTGPDGA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcagcattttctggcatcagaatacagccctgttttgcctgaacaggcgggttttcat
atcatccccgttccgcttgagcagagcgtttcttacggcgcgggtacggctggcggccct
gcggctctgctcgaggcctcgcagcagcttgaagcctgggaatgcggacatgccccgggc
gagacaggtttttataccgcgccgcctgtggactgcggcggccctgttgaaaaggtgctc
gaccgcatcgaggctgccacggcccgcgccatttcgtgtgcggccctgcccgtgctgctc
ggcggcgagcataccgttacccttggcgcactgcgcgccctggcaaaagaagcgcaacgc
agtcgcgagcctttcggcatcgtgcagttcgacgcccatgccgacctgcggtcttcgtat
gaaggaagcccctattcccacgcctgtgtgatgcaccgtgccgtggccgatcttggcctg
ccgctggtgcagtttgccgtgcgcgacttttgccgcgaagaggccgaggtgcgcaaggcg
cataatgttacgcattatgatgcctatttcatggcgcgtgtgggcctgcccgagcagccc
ctgcccgaggattttccccggcgtatctatatcacctttgatgtggacgcgtttgacgca
tcactcatgcctgccacaggcacaccttcgcccggcggcataagctggcgcgaggcccac
ttcattcttgagcgctgcgtggccgggcgcagggtaatcgggcttgatgtggtggagctg
gcgcccatacaggggctgcaccattgcaactttacggcggccaaactgacgcatctgctt
atggggctggcccatgcggccaataccggcccggatggggcatga

DBGET integrated database retrieval system