KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_0105Help
Entry
Ddes_0105         CDS       T00837                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dds01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dds00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:dds00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
137283..138728
Genome map
AA seq 481 aa AA seqDB search
MAHADFPAYRGRMEYVCLDCGARYPGDSLLYTCPQCGGVFLLENLDFARLKERSGQEWRK
IFDDRCASRSTALKGIFRYYELLAPLLDEDDIVYLGEGITPVVEASAALRDMTGVAFAYK
NDGQNPSASFKDRGMACAFSYLKWLCRRNQWDEVLTVCASTGDTSAAAALYASYVGAPLK
SVVLLPHGKVTPQQLAQPLGSGATVLELPGVFDDCMKVVELLAENYRVALLNSKNSWRIL
GQESYAYEVAQWYGWDMTDQCLFVPIGNAGNVTAIMSGFLKMLDLGMITGLPRIFGVQSE
HADPVWRYYDAPAGSRCWQPVTVQPSVAQAAMIGNPVSFPRVRMLAERFMESGGERAFQV
VRVTEQQIMDAMIMANRHGHIACTQGGECLAGLRNARTLGLVGDHEHAVLDATAHALKFA
GFQDMYFNDAFPPEYGVSPDKSLANLPELLLPQSAREGRDVAEFASLGAEAVVQRLKLQK
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgcggattttccggcctatcgcggccgcatggaatatgtctgccttgattgc
ggcgcgcgctacccgggcgacagcctgctgtatacctgcccgcagtgcggcggcgttttt
ctgctggaaaacctggattttgccaggctcaaagaacgcagcggccaggaatggcgaaag
atttttgacgatcgctgcgccagccgctccacagcgctcaaggggattttccggtattac
gagctgctcgcccccctgctggacgaagacgatatcgtctatctgggcgaaggcattact
ccggtggtggaagcttccgctgccctgcgtgacatgacgggcgtggcttttgcctacaaa
aatgacgggcagaaccccagcgcctccttcaaggacaggggcatggcctgtgccttcagc
tatctcaagtggctttgccgtcgcaaccagtgggacgaagtgctgacggtctgcgcctcc
accggcgacacttcggcagccgcggccctgtacgcctcctatgtaggcgcgccgctcaaa
tccgtggtactgctgccccacggcaaggtgacgccccagcagcttgcgcagccccttggc
agcggcgccacagtgctggaattgcccggcgtgtttgacgactgcatgaaggtggtggag
ctgctggcagaaaactaccgcgtggcgctgctcaactccaagaacagctggcgcattctg
gggcaggagtcctacgcgtatgaagtggcccagtggtatggctgggatatgacggaccag
tgtctctttgtgcccattggcaatgcgggcaacgtcaccgccatcatgtcgggctttttg
aaaatgcttgatcttggcatgattacgggcctgccgcgcatcttcggcgtgcagtccgag
catgccgatccggtgtggcgctactatgacgcccccgcaggctcccgctgctggcagccg
gtgaccgtacagcccagcgtggcccaggcggccatgataggcaatcccgtttcatttccg
cgcgtgcgcatgctggccgagcggtttatggaaagcggcggcgagcgcgccttccaggtg
gtgcgcgtaaccgagcagcagattatggatgcgatgattatggcaaaccgtcacggtcac
attgcctgtacccagggcggcgaatgtttggccggtttgcgcaatgcccgcactctgggc
cttgtgggcgaccacgagcacgctgtgcttgacgccacggcccatgccctcaagtttgcc
gggtttcaggacatgtatttcaacgatgccttcccgcccgagtatggcgtatcgccggac
aagagcctggcaaacctgccggaactgcttctgccccagagcgcccgcgaagggcgggat
gtggcggaattcgcctcactgggggcggaagcagtggtgcagcgtttgaaattgcagaaa
aaataa

DBGET integrated database retrieval system