KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_0105Help
Entry
Ddes_0105         CDS       T00837                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ddes_0105
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ddes_0105
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ddes_0105
Enzymes [BR:dds01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ddes_0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
137283..138728
Genome map
AA seq 481 aa AA seqDB search
MAHADFPAYRGRMEYVCLDCGARYPGDSLLYTCPQCGGVFLLENLDFARLKERSGQEWRK
IFDDRCASRSTALKGIFRYYELLAPLLDEDDIVYLGEGITPVVEASAALRDMTGVAFAYK
NDGQNPSASFKDRGMACAFSYLKWLCRRNQWDEVLTVCASTGDTSAAAALYASYVGAPLK
SVVLLPHGKVTPQQLAQPLGSGATVLELPGVFDDCMKVVELLAENYRVALLNSKNSWRIL
GQESYAYEVAQWYGWDMTDQCLFVPIGNAGNVTAIMSGFLKMLDLGMITGLPRIFGVQSE
HADPVWRYYDAPAGSRCWQPVTVQPSVAQAAMIGNPVSFPRVRMLAERFMESGGERAFQV
VRVTEQQIMDAMIMANRHGHIACTQGGECLAGLRNARTLGLVGDHEHAVLDATAHALKFA
GFQDMYFNDAFPPEYGVSPDKSLANLPELLLPQSAREGRDVAEFASLGAEAVVQRLKLQK
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgcggattttccggcctatcgcggccgcatggaatatgtctgccttgattgc
ggcgcgcgctacccgggcgacagcctgctgtatacctgcccgcagtgcggcggcgttttt
ctgctggaaaacctggattttgccaggctcaaagaacgcagcggccaggaatggcgaaag
atttttgacgatcgctgcgccagccgctccacagcgctcaaggggattttccggtattac
gagctgctcgcccccctgctggacgaagacgatatcgtctatctgggcgaaggcattact
ccggtggtggaagcttccgctgccctgcgtgacatgacgggcgtggcttttgcctacaaa
aatgacgggcagaaccccagcgcctccttcaaggacaggggcatggcctgtgccttcagc
tatctcaagtggctttgccgtcgcaaccagtgggacgaagtgctgacggtctgcgcctcc
accggcgacacttcggcagccgcggccctgtacgcctcctatgtaggcgcgccgctcaaa
tccgtggtactgctgccccacggcaaggtgacgccccagcagcttgcgcagccccttggc
agcggcgccacagtgctggaattgcccggcgtgtttgacgactgcatgaaggtggtggag
ctgctggcagaaaactaccgcgtggcgctgctcaactccaagaacagctggcgcattctg
gggcaggagtcctacgcgtatgaagtggcccagtggtatggctgggatatgacggaccag
tgtctctttgtgcccattggcaatgcgggcaacgtcaccgccatcatgtcgggctttttg
aaaatgcttgatcttggcatgattacgggcctgccgcgcatcttcggcgtgcagtccgag
catgccgatccggtgtggcgctactatgacgcccccgcaggctcccgctgctggcagccg
gtgaccgtacagcccagcgtggcccaggcggccatgataggcaatcccgtttcatttccg
cgcgtgcgcatgctggccgagcggtttatggaaagcggcggcgagcgcgccttccaggtg
gtgcgcgtaaccgagcagcagattatggatgcgatgattatggcaaaccgtcacggtcac
attgcctgtacccagggcggcgaatgtttggccggtttgcgcaatgcccgcactctgggc
cttgtgggcgaccacgagcacgctgtgcttgacgccacggcccatgccctcaagtttgcc
gggtttcaggacatgtatttcaacgatgccttcccgcccgagtatggcgtatcgccggac
aagagcctggcaaacctgccggaactgcttctgccccagagcgcccgcgaagggcgggat
gtggcggaattcgcctcactgggggcggaagcagtggtgcagcgtttgaaattgcagaaa
aaataa

DBGET integrated database retrieval system