KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_0105Help
Entry
Ddes_0105         CDS       T00837                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
dds00260  Glycine, serine and threonine metabolism
dds00750  Vitamin B6 metabolism
dds01100  Metabolic pathways
dds01110  Biosynthesis of secondary metabolites
dds01120  Microbial metabolism in diverse environments
dds01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ddes_0105
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ddes_0105
Enzymes [BR:dds01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ddes_0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP zf-TFIIB HypA Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: ACL48025
JGI: Ddes0105
UniProt: B8J230
Position
137283..138728
Genome map
AA seq 481 aa AA seqDB search
MAHADFPAYRGRMEYVCLDCGARYPGDSLLYTCPQCGGVFLLENLDFARLKERSGQEWRK
IFDDRCASRSTALKGIFRYYELLAPLLDEDDIVYLGEGITPVVEASAALRDMTGVAFAYK
NDGQNPSASFKDRGMACAFSYLKWLCRRNQWDEVLTVCASTGDTSAAAALYASYVGAPLK
SVVLLPHGKVTPQQLAQPLGSGATVLELPGVFDDCMKVVELLAENYRVALLNSKNSWRIL
GQESYAYEVAQWYGWDMTDQCLFVPIGNAGNVTAIMSGFLKMLDLGMITGLPRIFGVQSE
HADPVWRYYDAPAGSRCWQPVTVQPSVAQAAMIGNPVSFPRVRMLAERFMESGGERAFQV
VRVTEQQIMDAMIMANRHGHIACTQGGECLAGLRNARTLGLVGDHEHAVLDATAHALKFA
GFQDMYFNDAFPPEYGVSPDKSLANLPELLLPQSAREGRDVAEFASLGAEAVVQRLKLQK
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgcggattttccggcctatcgcggccgcatggaatatgtctgccttgattgc
ggcgcgcgctacccgggcgacagcctgctgtatacctgcccgcagtgcggcggcgttttt
ctgctggaaaacctggattttgccaggctcaaagaacgcagcggccaggaatggcgaaag
atttttgacgatcgctgcgccagccgctccacagcgctcaaggggattttccggtattac
gagctgctcgcccccctgctggacgaagacgatatcgtctatctgggcgaaggcattact
ccggtggtggaagcttccgctgccctgcgtgacatgacgggcgtggcttttgcctacaaa
aatgacgggcagaaccccagcgcctccttcaaggacaggggcatggcctgtgccttcagc
tatctcaagtggctttgccgtcgcaaccagtgggacgaagtgctgacggtctgcgcctcc
accggcgacacttcggcagccgcggccctgtacgcctcctatgtaggcgcgccgctcaaa
tccgtggtactgctgccccacggcaaggtgacgccccagcagcttgcgcagccccttggc
agcggcgccacagtgctggaattgcccggcgtgtttgacgactgcatgaaggtggtggag
ctgctggcagaaaactaccgcgtggcgctgctcaactccaagaacagctggcgcattctg
gggcaggagtcctacgcgtatgaagtggcccagtggtatggctgggatatgacggaccag
tgtctctttgtgcccattggcaatgcgggcaacgtcaccgccatcatgtcgggctttttg
aaaatgcttgatcttggcatgattacgggcctgccgcgcatcttcggcgtgcagtccgag
catgccgatccggtgtggcgctactatgacgcccccgcaggctcccgctgctggcagccg
gtgaccgtacagcccagcgtggcccaggcggccatgataggcaatcccgtttcatttccg
cgcgtgcgcatgctggccgagcggtttatggaaagcggcggcgagcgcgccttccaggtg
gtgcgcgtaaccgagcagcagattatggatgcgatgattatggcaaaccgtcacggtcac
attgcctgtacccagggcggcgaatgtttggccggtttgcgcaatgcccgcactctgggc
cttgtgggcgaccacgagcacgctgtgcttgacgccacggcccatgccctcaagtttgcc
gggtttcaggacatgtatttcaacgatgccttcccgcccgagtatggcgtatcgccggac
aagagcctggcaaacctgccggaactgcttctgccccagagcgcccgcgaagggcgggat
gtggcggaattcgcctcactgggggcggaagcagtggtgcagcgtttgaaattgcagaaa
aaataa

DBGET integrated database retrieval system