KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_0583Help
Entry
Ddes_0583         CDS       T00837                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ddes_0583
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ddes_0583
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ddes_0583
Enzymes [BR:dds01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ddes_0583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(707768..708979)
Genome map
AA seq 403 aa AA seqDB search
MSQHSAPHDKPDSNGFFGAYGGQYVPEPVKARLDELTAAMESALADPGFMQELNDLFIHY
TGRPSPVFHCANLSHKLGGAQIWLKREDLNHLGAHKINNTLGQCLLAKRMGKSRIIAETG
AGQHGVATAATAALMGLECTICMGEVDMERQHLNVIRMRMLGADVVAATSGQRTLKEAVD
EALALWVADDAMFYVLGSAVGPHPYPYMVRQFQSVVGSEAREQMLEACGRLPDAALACVG
GGSNAIGIFSGFVNDAGVRLIGVEPGGHGTDYGQHAASLCLGEPGVLHGFNSYMIKNAAG
DAGSVYSISAGLDYPSVGPEHSMLKDAGRAEYVSITDKEALEAFFTLSRHEGIIPALESS
HALAHAIKMAPGMPQDAILLVNLSGRGDKDVAQVAEMMEKGEI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcattccgcaccccacgacaaaccggacagcaacggctttttcggcgcttac
ggcggccagtatgttcccgaaccagtcaaggcccgcctggatgaactgactgcggctatg
gagtctgccctggccgaccccggcttcatgcaggaactcaacgaccttttcatccattat
acaggacgtccaagccctgtctttcactgcgccaacctgagccataaactgggcggcgcg
cagatatggctcaagcgcgaagacctcaaccatctcggggcgcacaagatcaacaataca
ctcggccagtgcctgctggccaagcgtatgggcaaaagccgcatcatcgccgaaaccggc
gcggggcagcacggcgtggctacagccgccacagccgcccttatgggacttgagtgcacc
atctgcatgggcgaagtggacatggagcgccagcacctcaacgtcatccgcatgcgcatg
ctcggagccgacgtcgtggcggccacatccggccagcgcacgctcaaggaagccgtggac
gaagcccttgccctgtgggtggcggacgatgccatgttttatgtgctgggctctgctgtg
ggaccgcacccctatccttatatggtacgccagttccagtctgtggtgggcagcgaggcc
cgcgagcagatgctcgaagcctgcggccgtctgcccgatgcggcgctggcctgcgtgggc
ggcggttcaaacgccatcggcattttttccggctttgtgaatgacgccggcgtgcgcctt
atcggcgtggaacccggcggacacggcacggactacggccagcacgcggcctcgctctgc
cttggcgaaccgggcgtactgcacggctttaattcctatatgatcaagaatgccgcaggc
gatgccggatctgtgtattccatatccgcaggactggactacccctcggtaggcccggaa
cactccatgctcaaggatgcgggccgcgccgaatatgtcagcattaccgacaaggaagcc
ctggaagccttcttcaccctgtcccgccacgaaggcatcatcccggcacttgaatcatcc
cacgccctggcacatgccatcaagatggccccgggcatgccgcaggatgccatcctgctg
gtcaacctttccggccggggagacaaggatgtggcacaagtagcggaaatgatggaaaaa
ggcgaaatctga

DBGET integrated database retrieval system