KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_0875Help
Entry
Ddes_0875         CDS       T00837                                 

Definition
polysaccharide biosynthesis domain-containing protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:dds00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:dds00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1024384..1024881)
Genome map
AA seq 165 aa AA seqDB search
MNALETVARNVGIDGALLQSLGIIPTPGGPVLHMLRPGSALLPDFSKGFGEVYFSEVLPG
HIKAWKRHTRQVQHFAVPTGLLRIVLYDGRPDSPTEGVVCELALGRPENYFLLRIPTGVW
YGFAAMGDAPALICNCADIPHDPAEGQRLPVDDPSIPYCWKTEKA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccctcgaaaccgtggcccggaatgtgggcattgacggggcactgctgcaatca
ctgggaataattcccacacccggcggaccggtgctgcacatgctgcgccccggttccgcc
ctgctgccggacttcagtaagggattcggtgaagtatacttttcagaagtcctgcccggc
cacatcaaggcctggaagcgtcatacccggcaggtgcagcactttgccgtacccacggga
ctactgcgcattgtgctttacgacggccgcccggattcccccaccgagggcgtcgtgtgt
gaactggccctgggtaggccggaaaactattttctcctgcgtattcccacgggcgtatgg
tacggctttgccgccatgggtgatgccccggcgctcatctgcaactgcgcggatatccct
cacgatcccgccgagggacagcgcctgcccgtggacgatccgtccattccctattgctgg
aaaacggaaaaggcataa

DBGET integrated database retrieval system