KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1108Help
Entry
Ddes_1108         CDS       T00837                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ddes_1108
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ddes_1108
Enzymes [BR:dds01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Ddes_1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1300088..1301542
Genome map
AA seq 484 aa AA seqDB search
MNREFAALLDECGRGEIEVRADSRQVCPGDIFVAVPGVREDGAQFIPAAAEAGAGVIVCR
ADSEEAAAAATAGCRVVHHADPREALWRLAQARWHTDTLPIRIVGVTGTNGKTTCTYLLE
RLFAQAGHKLGVMGTVSYRWPGHVEAAPLTTPDALSVHAMLAAMARDGVDVAVMEVSSHA
IDQQRVCGVPFSGAAFTNLSQDHLDYHRDMESYFQAKARLFLELPRADKSMAVNADDAWG
RRLLELCPTALSFGLQKGAPNRRHLWGELLSSTTAGCHLRMSLEDMQWELRSPLVGAFNA
SNLLAVQAVALEMGIDPEAFKALESFTGVSGRLERVENPQGLNVFVDYAHTPDALENVLK
ALRDAGFERVITVFGCGGNRDRSKRPIMGEAVARWSDVAVLTSDNPRFEDPEAILKDVLP
GLADAKEVVVEVDRREATTRALGMLGKKDALLIAGKGHEDYQIIQGVKHHYSDQEVVREI
LRCA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgggaatttgcggcactgctggatgagtgcggacgcggcgagattgaagtgcgc
gcagactcgcgtcaggtatgtcccggcgatatttttgtggctgtacctggcgtcagggaa
gacggcgcccagtttatccctgctgccgctgaagccggggcgggagtcattgtttgccgg
gccgacagtgaagaggctgcagctgcagcgaccgccgggtgcagggtcgtccaccatgcc
gatccgcgtgaggcgctctggcggctggcacaggcccgctggcatacagataccttgcct
atccgtattgtgggtgttacaggcaccaacggcaaaaccacctgcacctatctgcttgaa
cgccttttcgcccaggcagggcataagctcggcgtgatgggaacagtgagctatcgctgg
cccggccatgttgaggcggcccccctgaccactcctgatgccttgagcgtgcatgccatg
ctggccgcaatggcccgcgatggcgtggacgtggccgtgatggaagtctcctctcatgcc
atagaccagcagcgggtgtgcggtgtgccgttttccggcgcggccttcaccaacctgagc
caggatcatctcgattatcatcgggatatggaaagttattttcaggccaaggccaggctt
tttcttgagctgccgcgcgccgacaaatccatggccgtcaatgctgacgatgcctggggc
cggcgcctgctggagctgtgtcccacggctctttccttcggtctgcaaaagggtgcgccc
aacaggcggcacctgtggggagagctgctttcttccaccacagcaggctgtcatctgcgt
atgagccttgaagacatgcagtgggagctacgctctccccttgtgggggctttcaatgct
tccaacctgctggctgtgcaggctgtggctctggaaatgggaattgatcctgaagccttc
aaggctcttgaaagctttacgggggtcagcggcaggctggagcgggtggaaaatccgcaa
ggactcaatgtttttgtggattatgcccatactcccgatgcacttgagaatgttctcaag
gccctgcgcgatgcaggctttgaacgcgtgatcactgtttttggctgtggcggtaaccgt
gaccgcagcaagagacccatcatgggagaagctgtggcccgctggtcggacgtggccgtg
ctgacctcggacaatccgcggtttgaagatccggaggccatactcaaggatgtgttgcct
ggccttgcagatgccaaagaggttgtcgtcgaggttgaccgtcgcgaggccaccacccgg
gctttgggcatgcttggcaaaaaagatgcgttgcttattgccggcaaagggcatgaagac
taccagattattcagggggttaaacaccattacagcgatcaggaagtggtgcgggagata
ctccggtgcgcataa

DBGET integrated database retrieval system