KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1176Help
Entry
Ddes_1176         CDS       T00837                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ddes_1176
   01230 Biosynthesis of amino acids
    Ddes_1176
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ddes_1176
   00051 Fructose and mannose metabolism
    Ddes_1176
   00562 Inositol phosphate metabolism
    Ddes_1176
Enzymes [BR:dds01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ddes_1176
Exosome [BR:dds04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ddes_1176
  Exosomal proteins of bladder cancer cells
   Ddes_1176
  Exosomal proteins of melanoma cells
   Ddes_1176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1384224..1384991
Genome map
AA seq 255 aa AA seqDB search
MHKIIAANWKMYKDRTQAATTAGELAAVLPEILPAGREVIVFPPFTAIESVARVFDGKKG
LAVGGQNFYPAPEGAFTGEISIDMLRDVGAQWVLAGHSERRHVFGESDELVARKAVFALS
HGLKTMLCIGEKLEEREQGSLYAVLERQLTAFFEARPDGMAGETLPGRLAIAYEPVWAIG
TGKVAGPGEVREAHGVTRALLERFVGDSGKKLPILYGGSVKPDNAGALIALDNVDGLLVG
GASLEAQSFLQIIGA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagattatcgctgcaaactggaagatgtacaaagaccgtactcaggccgccaca
accgctggcgagcttgcggccgttttgcccgaaattttacctgcgggacgcgaagttatc
gtctttccgccttttaccgccattgagagcgtagctcgtgtatttgacggtaaaaaaggg
ctggctgtgggcgggcagaatttttaccccgcgccggaaggtgcttttacgggtgaaatc
tctattgatatgctgcgtgatgtcggggcgcaatgggtgcttgccggacattccgaacgc
aggcatgtctttggcgagagtgatgagcttgtggcccgcaaggctgtgtttgcccttagc
catggcctcaaaaccatgctttgcataggggaaaaacttgaagagcgtgaacagggcagc
ctttatgctgtacttgagcggcagctgacggctttttttgaagccagacccgacggtatg
gctggtgaaaccctgccggggcgcttggccatcgcctatgaacccgtgtgggccataggt
acaggcaaggtggctggccctggtgaagtacgtgaggcgcacggcgttacgcgggccttg
cttgaaagatttgtgggtgattccggcaaaaaactgccgattttgtatggcggcagcgta
aaaccggataatgccggagcacttatcgcccttgacaatgtggatggtcttttggtagga
ggagcctctttagaggcgcaaagcttcttacaaattatcggggcctga

DBGET integrated database retrieval system