KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1176Help
Entry
Ddes_1176         CDS       T00837                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
dds00010  Glycolysis / Gluconeogenesis
dds00051  Fructose and mannose metabolism
dds00562  Inositol phosphate metabolism
dds01100  Metabolic pathways
dds01110  Biosynthesis of secondary metabolites
dds01120  Microbial metabolism in diverse environments
dds01130  Biosynthesis of antibiotics
dds01200  Carbon metabolism
dds01230  Biosynthesis of amino acids
Module
dds_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dds_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ddes_1176
   00051 Fructose and mannose metabolism
    Ddes_1176
   00562 Inositol phosphate metabolism
    Ddes_1176
Enzymes [BR:dds01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ddes_1176
Exosome [BR:dds04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ddes_1176
  Exosomal proteins of bladder cancer cells
   Ddes_1176
  Exosomal proteins of melanoma cells
   Ddes_1176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACL49080
JGI: Ddes1176
UniProt: B8J003
Position
1384224..1384991
Genome map
AA seq 255 aa AA seqDB search
MHKIIAANWKMYKDRTQAATTAGELAAVLPEILPAGREVIVFPPFTAIESVARVFDGKKG
LAVGGQNFYPAPEGAFTGEISIDMLRDVGAQWVLAGHSERRHVFGESDELVARKAVFALS
HGLKTMLCIGEKLEEREQGSLYAVLERQLTAFFEARPDGMAGETLPGRLAIAYEPVWAIG
TGKVAGPGEVREAHGVTRALLERFVGDSGKKLPILYGGSVKPDNAGALIALDNVDGLLVG
GASLEAQSFLQIIGA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagattatcgctgcaaactggaagatgtacaaagaccgtactcaggccgccaca
accgctggcgagcttgcggccgttttgcccgaaattttacctgcgggacgcgaagttatc
gtctttccgccttttaccgccattgagagcgtagctcgtgtatttgacggtaaaaaaggg
ctggctgtgggcgggcagaatttttaccccgcgccggaaggtgcttttacgggtgaaatc
tctattgatatgctgcgtgatgtcggggcgcaatgggtgcttgccggacattccgaacgc
aggcatgtctttggcgagagtgatgagcttgtggcccgcaaggctgtgtttgcccttagc
catggcctcaaaaccatgctttgcataggggaaaaacttgaagagcgtgaacagggcagc
ctttatgctgtacttgagcggcagctgacggctttttttgaagccagacccgacggtatg
gctggtgaaaccctgccggggcgcttggccatcgcctatgaacccgtgtgggccataggt
acaggcaaggtggctggccctggtgaagtacgtgaggcgcacggcgttacgcgggccttg
cttgaaagatttgtgggtgattccggcaaaaaactgccgattttgtatggcggcagcgta
aaaccggataatgccggagcacttatcgcccttgacaatgtggatggtcttttggtagga
ggagcctctttagaggcgcaaagcttcttacaaattatcggggcctga

DBGET integrated database retrieval system