KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1176Help
Entry
Ddes_1176         CDS       T00837                                 

Definition
(RefSeq) Triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ddes_1176
   01230 Biosynthesis of amino acids
    Ddes_1176
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ddes_1176
   00051 Fructose and mannose metabolism
    Ddes_1176
   00562 Inositol phosphate metabolism
    Ddes_1176
Enzymes [BR:dds01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ddes_1176
Exosome [BR:dds04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ddes_1176
  Exosomal proteins of bladder cancer cells
   Ddes_1176
  Exosomal proteins of melanoma cells
   Ddes_1176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1384224..1384991
Genome map
AA seq 255 aa AA seqDB search
MHKIIAANWKMYKDRTQAATTAGELAAVLPEILPAGREVIVFPPFTAIESVARVFDGKKG
LAVGGQNFYPAPEGAFTGEISIDMLRDVGAQWVLAGHSERRHVFGESDELVARKAVFALS
HGLKTMLCIGEKLEEREQGSLYAVLERQLTAFFEARPDGMAGETLPGRLAIAYEPVWAIG
TGKVAGPGEVREAHGVTRALLERFVGDSGKKLPILYGGSVKPDNAGALIALDNVDGLLVG
GASLEAQSFLQIIGA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagattatcgctgcaaactggaagatgtacaaagaccgtactcaggccgccaca
accgctggcgagcttgcggccgttttgcccgaaattttacctgcgggacgcgaagttatc
gtctttccgccttttaccgccattgagagcgtagctcgtgtatttgacggtaaaaaaggg
ctggctgtgggcgggcagaatttttaccccgcgccggaaggtgcttttacgggtgaaatc
tctattgatatgctgcgtgatgtcggggcgcaatgggtgcttgccggacattccgaacgc
aggcatgtctttggcgagagtgatgagcttgtggcccgcaaggctgtgtttgcccttagc
catggcctcaaaaccatgctttgcataggggaaaaacttgaagagcgtgaacagggcagc
ctttatgctgtacttgagcggcagctgacggctttttttgaagccagacccgacggtatg
gctggtgaaaccctgccggggcgcttggccatcgcctatgaacccgtgtgggccataggt
acaggcaaggtggctggccctggtgaagtacgtgaggcgcacggcgttacgcgggccttg
cttgaaagatttgtgggtgattccggcaaaaaactgccgattttgtatggcggcagcgta
aaaccggataatgccggagcacttatcgcccttgacaatgtggatggtcttttggtagga
ggagcctctttagaggcgcaaagcttcttacaaattatcggggcctga

DBGET integrated database retrieval system