KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1321Help
Entry
Ddes_1321         CDS       T00837                                 

Definition
alpha amylase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ddes_1321
Enzymes [BR:dds01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Ddes_1321
Exosome [BR:dds04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ddes_1321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1570769..1572808
Genome map
AA seq 679 aa AA seqDB search
MTSLAPQTPLQDTALQPYSFFLQQRGKIFSTELARITKQYGSLRAYANLHHKLGVHKVRD
AEGRSFWQLREYMPHAAALWLTTDTLNFQRHVHFQFIPQAKGFFELFVPEEALHHGSYME
LRVQPGNAADGDRALRRVPAFANWVEQDTVMPGQWCARLWLPEKAFRFTHQPPDRQPFPR
IYEAHVGMAQSSQQRSTNSVGSYAAFVAHVLPRIRECGYTAVQLMGILEHPLYRSFGYQV
SSYFAPSSRYGTPDEFKSLVDAAHGLGLAVILDIPHAHACPNTEQGLARYDGSDYFFSGT
LNQWGTPSFDFSQEMTRRFLLSNCRYWLEEYRIDGFRSDAVGNILYLDHGMDDDFSHVSR
CFYDKDGKPRGNTYGELYLALSNTLTHQICPSAITIAEEFSGMPGLTCSPEQGGLGFDYR
FAMGIPDYWAKCVISPHDMGSMWHEMTNHRPYDRTISYVECHDQCINGKDAMIWRLLGER
MYSHMAVATDSWDVSRGLAFYRLMRLITLAAADAGYLSFMGNEFGHPEWLDAENYAHRQW
HLAQAPDLKYSFLAAWDKAQMLELVQPHLNSFRQPPLFRFIHEEKRLLAFERGQLLFAFN
FHELDAQKNLTFAVSPGKYVELLSSDEKRFAGHGNLDISGQPVEHFTQPLADRHEGDIHL
YLPPLVGLVLLRKNNLKKD
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgacatcacttgctccccaaacccccttacaagatacggcattgcagccttacagtttt
tttctgcagcaaaggggcaagatattttcgacagaattggcccgcatcacaaaacagtac
ggctcattgcgggcctacgccaatctgcaccacaagcttggtgtgcataaagtcagggat
gccgaaggccgcagcttctggcagctgcgcgagtatatgccccatgcggcggccttgtgg
ctgacgaccgatacgctcaactttcagcgccacgtccattttcagtttatcccccaggca
aaaggcttttttgaactgtttgtgcccgaagaagcgctccaccacggaagctatatggag
ctgcgtgtgcagcccggcaatgccgccgatggagatcgcgccctgcgccgggttccggct
tttgccaactgggtggaacaagatacggtcatgcccggccagtggtgcgcccggctctgg
ctgccggaaaaagcttttcgctttacacaccaacccccggacaggcagccttttccacgt
atttacgaagcacatgtgggcatggcccaatcctctcagcagcgcagtacgaacagcgtg
ggcagctatgcggcctttgtcgcgcacgttttgccgcgtatacgtgaatgcggctatacc
gcagtccagcttatgggcattctggaacacccgctctaccgttcttttggctatcaggtc
agcagttattttgcgccatcctcccgctatggaactcccgacgaattcaagtcccttgtg
gacgcggcgcatggtctcggccttgccgtcatccttgatattccgcatgcccatgcctgc
cccaataccgagcaggggctcgcccgctacgacggaagcgattattttttcagcggcaca
ctgaatcagtggggtacgccgtcgtttgacttcagccaggagatgacgcgccgttttctg
ctctccaactgccgctactggcttgaagaataccgcatagacggttttcgttccgacgct
gtgggcaacatcctgtaccttgatcacggtatggatgacgatttttcccatgtaagccgc
tgcttctacgacaaggacggcaaaccgcgcggcaatacgtacggcgaactgtatctggcc
ctgtccaacaccctgacgcaccagatatgcccctctgccataaccattgccgaagaattt
tccggcatgcccggcctcacctgttccccggaacagggcggactcggctttgactaccgc
tttgccatgggcatacccgactattgggcaaaatgtgtcatcagcccacacgatatgggc
agcatgtggcatgaaatgaccaaccacaggccgtatgaccgtaccatcagctatgtggag
tgccacgaccagtgcataaacggcaaagatgccatgatctggcggctgctcggcgagcgt
atgtacagccacatggctgttgcaacagacagttgggacgtatcacgcgggctcgctttt
taccgtctcatgcgccttattacgctggctgctgctgacgcgggctatctcagctttatg
ggcaacgaatttggacaccccgaatggcttgatgcggaaaactatgcccacaggcagtgg
cacctggctcaggctcctgaccttaagtacagcttcctggccgcctgggacaaagcgcag
atgctggaactggttcaaccgcacctgaacagttttaggcaacctcctcttttccgtttt
attcatgaagagaaacgattgctggcctttgagcgggggcagctgctttttgcctttaac
tttcatgaacttgatgcccaaaaaaatctgacgtttgccgtttctcccggtaagtatgtc
gaactgctgtcctcggatgaaaagcgtttcgccgggcacggtaatcttgacatatccggc
cagcctgtggaacattttacccaaccgctggccgatcgccatgagggagacatccacctg
tatctgccccctttggttggtttggtattgctgagaaaaaataatttaaaaaaagattga

DBGET integrated database retrieval system