KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1377Help
Entry
Ddes_1377         CDS       T00837                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dds00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ddes_1377
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Ddes_1377
Enzymes [BR:dds01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Ddes_1377
Two-component system [BR:dds02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Ddes_1377
Bacterial motility proteins [BR:dds02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ddes_1377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1649052..1650122
Genome map
AA seq 356 aa AA seqDB search
MIRVLVVDDSTFMRNAITALLEQDPEIKVAGTAKDGLEALKKAEELDADVMTLDVEMPRL
DGLGTLQRLMKATPMPVLMISSLTESGAESTLKAMEYGALDFIPKNMSNDRDAFGAELRR
KVTALARRKTIIRLKYRRINNIPMPAATPRTQPQQPADYVQTPCPGPRDLVVIGVSTGGP
PVVQKILSALPPDIPACFLIAQHMPAAFTGPFAKRLDSVCRIDVTEAQDGDRLKNGHAYV
CPGGRHISVRMRGPLPEVAVTEEPRDALYKPTVNLLMESAGKLMGRRTLGVMLTGMGSDG
CEGARVLREKGGCLIAQNEASCVVYGMPKAVVDAKLANQILDADDIAQAIMTIIRG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtgttcttgtagtcgacgattccacttttatgcgaaatgccattaccgccctg
ctggaacaggatccggaaatcaaggttgccggtactgccaaagatggattggaagccctg
aaaaaagccgaagaactagatgcggacgtcatgaccctggatgtggaaatgccgcgtctt
gacggcctggggaccctccagcggcttatgaaggccacccccatgccggtactcatgatc
agctctctgaccgaaagtggcgcagaaagcaccttaaaagctatggagtacggcgcactg
gactttattcccaaaaatatgagcaatgatcgtgatgccttcggcgcggaactgcggcgc
aaggtcacggctctggcacgccgcaaaacgattatccgtctcaagtaccgccgtatcaac
aatatccccatgccggccgccacgccgcgcacacagccgcagcagcccgccgattatgtg
cagactccctgccccgggccgcgcgatctggtagttatcggcgtgtccaccggggggccg
ccggtggtgcaaaaaatactttctgccctgcctccggacattccggcctgcttcctgatt
gcacagcatatgcccgcagcctttaccggcccttttgccaaaaggctcgacagcgtatgc
cgcatagacgtcactgaagcgcaggacggcgatcgtttgaagaacggacacgcctacgtc
tgtcccggcggcaggcacataagcgtccgcatgcgcggtcccctgcccgaagtggctgtg
accgaagagccgcgcgacgccctttacaagcccacggtcaacctgcttatggaaagtgcg
ggcaagcttatggggcgccgcaccctgggcgtcatgctcacgggcatgggttcggacgga
tgtgagggcgcaagggttttgagagaaaaaggcggctgcctcattgcccagaatgaagcc
tcttgtgtagtgtacggcatgcccaaggcagtagtggacgccaagcttgcaaaccagatt
ctcgacgccgacgacatagcccaggccatcatgacgataatcagaggctga

DBGET integrated database retrieval system