KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1390Help
Entry
Ddes_1390         CDS       T00837                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ddes_1390
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ddes_1390
   00052 Galactose metabolism
    Ddes_1390
   00500 Starch and sucrose metabolism
    Ddes_1390
   00520 Amino sugar and nucleotide sugar metabolism
    Ddes_1390
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ddes_1390
   00524 Butirosin and neomycin biosynthesis
    Ddes_1390
Enzymes [BR:dds01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ddes_1390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1663537..1664568)
Genome map
AA seq 343 aa AA seqDB search
MQRILVADVGGTNCRMGSFRLEGTSLTLECSVRISSSGLENGQDLFFALAEGLRLSPEQA
GAVVIGLAGPVDGQKGSLTNGRLRVDLADISPLPAAGRCLLLNDFILQAYATLTPPGVQA
LHVAGPAQKNDGSADAVSSGEEEGGLIKGVHSGNIHAVIGAGTGLGAASLLLSEQGRPVA
VPSEAGHAAFAFLGKEEQDYGRALCKGLERPFASAENVLCGQGLSTLHYYLTGRMLHPSQ
VGDSALSRDTPTLHWYARFLGRFCRGWILSTLCREGLWIAGGVAAANPLCVNCQSFSEAL
YADSGDVMSLLQCVPVRLVTDTDSGLWGGAYAGAALLQDSECM
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaattcttgtggccgatgtggggggaaccaactgccggatgggcagcttcagg
ctggagggaacctcgcttacgcttgaatgctctgtgcggatcagttcttcggggctggaa
aacgggcaggacctgtttttcgctctggccgaaggcctgcgcctgtcgccggaacaggcc
ggagccgtggtcatcgggctggccgggcctgtggacgggcagaagggaagcctgaccaat
gggcggctgcgcgttgaccttgcagatatctctccgctgccggctgccgggcgctgcctg
ctgctgaatgactttatccttcaggcgtatgccaccctgacccctcctggcgttcaggct
ctacatgtggctgggcctgcacaaaaaaatgatggaagcgccgatgccgtttcttctggt
gaagaagagggcggcttgataaagggcgtacactccggaaatatccacgctgtcatcggt
gccgggacaggtcttggagccgccagtctgctgctttccgagcagggaagaccggtggct
gttcccagtgaagccggacacgctgctttcgcctttcttggcaaagaagagcaggattac
ggacgggctttgtgcaaagggctggagcggccttttgccagtgctgaaaacgtgctttgc
ggacaggggctttccacgctgcattactatctgacaggccggatgctgcatccttctcag
gtgggcgatagtgcgctttcgcgtgatacgcccactttgcattggtatgcgcgttttctg
gggcggttttgtcggggatggatattgtctaccctttgtcgtgaagggttgtggattgcc
gggggtgtggcggccgccaatcctctttgcgtaaattgtcagtctttttcagaagctctg
tatgctgattcgggggatgtcatgtccctgctgcagtgtgtgcctgtgcgccttgtaaca
gataccgacagcggcctttggggaggtgcgtatgccggggcggcattactgcaggacagt
gaatgcatgtag

DBGET integrated database retrieval system