KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1406Help
Entry
Ddes_1406         CDS       T00837                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Ddes_1406
Enzymes [BR:dds01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Ddes_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1681356..1681964
Genome map
AA seq 202 aa AA seqDB search
MPRQGIALVLSAPSGAGKTTLVQRLLRAFPLLGYSVSCTTRLPRQGEVDGKDYIFISREE
FEQRRAEGYFAEWAEVHGNLYGTPLAPVKEKLRLGQDLLFDIDVQGAAQLKLSLTEAVFV
FILPPGMTELERRLRNRGLDDEKTIERRLANARQEILEARWYDALVVNDNLDVAYDELRS
VFVAASLAPDRNPDLSETVLRG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgccccgacaaggcattgccctggtcttgagcgccccctccggggctggaaaaacgaca
ttggttcaacgcctgctgcgggccttccccctgctgggctactctgtttcctgcaccacg
cgcctgccccggcagggcgaagtggacggcaaggactatatattcatcagccgtgaagaa
tttgaacagcgccgcgccgaaggctattttgccgaatgggccgaagtgcacggcaatctt
tacggcacgccgctggccccggtgaaggaaaaactgcgccttgggcaggacctgcttttt
gacattgacgtgcagggcgccgcccagctcaagctttccttgaccgaggcggtctttgtt
ttcatactgccgcccggcatgaccgagcttgaacgccgcctgcgcaaccggggcctggat
gatgaaaaaaccattgagcgccgcctggccaacgcccggcaggaaatactcgaagcccgc
tggtatgatgcgcttgtggtcaatgacaacctggacgtggcctatgacgagctgcgctcg
gtttttgtggcggcaagccttgcccccgaccgcaaccccgacctgtcggaaacagtgctg
cgcggctga

DBGET integrated database retrieval system