KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1423Help
Entry
Ddes_1423         CDS       T00837                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:dds01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dds01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dds00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dds00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dds00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dds00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:dds00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1702022..1703329
Genome map
AA seq 435 aa AA seqDB search
MNKECTLQTDIRTLGPCKLDSHLPYRTWADDRTVQIFVDEDLTDDAGKAFSVCLEAAGPR
KKLYFDSTRAKCAIVTCGGLCPGINDVIRAIVMEAFHAYNVPSILGIPYGLEGFIPKYGH
TLQELTPKGVADIHRFGGTMLGSSRGPQSAEEIVDALERSNVNILFVIGGDGTMKAARAI
STEIQARNLKLAVIGIPKTIDNDINFIPQSFGFETAVYKATEAIECAHTEACGVPNGIGL
VKLMGRESGFIAARAALALKEVNFVLIPEAPFSLEGEGGLLPALEERLKARGHAVIVAAE
GAGQHLLAEQNGTDASGNPVLGDISELLRTSINTYLDTRGVAHSIKYIDPSYIIRSIPAS
ANDKVYCGFLGQYAVHAAMAGRTHMVVGKIQDRYVHLPLELVTRKRRKLNIYSDLWRAVL
ESTGQGMLKGMLPPI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagaatgtactctgcaaacggatatacgcacccttggtccctgcaagctcgat
tcccacctgccctatcgcacctgggccgatgacaggaccgtacagatttttgtggatgaa
gatctgacagacgacgccggcaaggcctttagcgtatgcctcgaggccgccgggccacgc
aaaaagctctactttgactccacgcgggccaaatgcgccatcgtgacctgcggcggcctt
tgccccggcatcaacgatgtcatacgggccatcgtaatggaggcctttcatgcgtacaac
gtgccgtccatcctgggtattccttacggtcttgaaggctttatccccaagtacggtcac
accctccaggaactgacgcccaaaggcgtggctgacatccatcgctttggcggaaccatg
ctcgggtcttcacgcgggccgcagtccgccgaggaaattgtggacgcccttgaacgcagc
aatgtcaatattctttttgtgatcggcggcgacgggactatgaaggccgcgcgggccatc
agtacagaaattcaggcccgcaacctgaaacttgccgttatcggcattcccaaaaccatt
gataatgacatcaacttcattccccagtccttcggctttgaaaccgctgtctacaaggcc
acagaagccattgaatgcgcccacaccgaagcgtgcggcgttcccaacggcattgggctg
gtgaagcttatggggcgcgaatcgggttttatcgccgcccgggccgcgctggcgctcaag
gaagtaaactttgtgctcattcccgaagcgccattcagccttgaaggtgaaggggggctt
ctgcctgctctggaagaacgcctgaaagcgcggggacatgccgtcatcgttgccgccgaa
ggggccgggcaacatttgcttgcggaacagaacggcaccgatgcctccggcaatcccgtg
ctcggcgacatctccgaactcctgcgcacgtccatcaacacctatctggacacacgtggc
gtggctcactccataaaatatatcgacccgagctatatcatccgctccattcccgccagc
gccaacgacaaggtttactgcggctttctgggccagtacgcggtgcacgccgccatggcg
ggtcgcacacatatggtggtggggaaaattcaggaccgctacgtgcacctgccgctggaa
ctggtcacgcgcaagcgccgcaaactcaatatctattccgacctgtggcgggccgtactt
gaatccacggggcaaggcatgctcaagggcatgctgccaccgatatag

DBGET integrated database retrieval system