KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1423Help
Entry
Ddes_1423         CDS       T00837                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ddes_1423
   01230 Biosynthesis of amino acids
    Ddes_1423
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ddes_1423
   00030 Pentose phosphate pathway
    Ddes_1423
   00051 Fructose and mannose metabolism
    Ddes_1423
   00052 Galactose metabolism
    Ddes_1423
  Energy metabolism
   00680 Methane metabolism
    Ddes_1423
Enzymes [BR:dds01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ddes_1423
Protein phosphatases and associated proteins [BR:dds01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ddes_1423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1702022..1703329
Genome map
AA seq 435 aa AA seqDB search
MNKECTLQTDIRTLGPCKLDSHLPYRTWADDRTVQIFVDEDLTDDAGKAFSVCLEAAGPR
KKLYFDSTRAKCAIVTCGGLCPGINDVIRAIVMEAFHAYNVPSILGIPYGLEGFIPKYGH
TLQELTPKGVADIHRFGGTMLGSSRGPQSAEEIVDALERSNVNILFVIGGDGTMKAARAI
STEIQARNLKLAVIGIPKTIDNDINFIPQSFGFETAVYKATEAIECAHTEACGVPNGIGL
VKLMGRESGFIAARAALALKEVNFVLIPEAPFSLEGEGGLLPALEERLKARGHAVIVAAE
GAGQHLLAEQNGTDASGNPVLGDISELLRTSINTYLDTRGVAHSIKYIDPSYIIRSIPAS
ANDKVYCGFLGQYAVHAAMAGRTHMVVGKIQDRYVHLPLELVTRKRRKLNIYSDLWRAVL
ESTGQGMLKGMLPPI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagaatgtactctgcaaacggatatacgcacccttggtccctgcaagctcgat
tcccacctgccctatcgcacctgggccgatgacaggaccgtacagatttttgtggatgaa
gatctgacagacgacgccggcaaggcctttagcgtatgcctcgaggccgccgggccacgc
aaaaagctctactttgactccacgcgggccaaatgcgccatcgtgacctgcggcggcctt
tgccccggcatcaacgatgtcatacgggccatcgtaatggaggcctttcatgcgtacaac
gtgccgtccatcctgggtattccttacggtcttgaaggctttatccccaagtacggtcac
accctccaggaactgacgcccaaaggcgtggctgacatccatcgctttggcggaaccatg
ctcgggtcttcacgcgggccgcagtccgccgaggaaattgtggacgcccttgaacgcagc
aatgtcaatattctttttgtgatcggcggcgacgggactatgaaggccgcgcgggccatc
agtacagaaattcaggcccgcaacctgaaacttgccgttatcggcattcccaaaaccatt
gataatgacatcaacttcattccccagtccttcggctttgaaaccgctgtctacaaggcc
acagaagccattgaatgcgcccacaccgaagcgtgcggcgttcccaacggcattgggctg
gtgaagcttatggggcgcgaatcgggttttatcgccgcccgggccgcgctggcgctcaag
gaagtaaactttgtgctcattcccgaagcgccattcagccttgaaggtgaaggggggctt
ctgcctgctctggaagaacgcctgaaagcgcggggacatgccgtcatcgttgccgccgaa
ggggccgggcaacatttgcttgcggaacagaacggcaccgatgcctccggcaatcccgtg
ctcggcgacatctccgaactcctgcgcacgtccatcaacacctatctggacacacgtggc
gtggctcactccataaaatatatcgacccgagctatatcatccgctccattcccgccagc
gccaacgacaaggtttactgcggctttctgggccagtacgcggtgcacgccgccatggcg
ggtcgcacacatatggtggtggggaaaattcaggaccgctacgtgcacctgccgctggaa
ctggtcacgcgcaagcgccgcaaactcaatatctattccgacctgtggcgggccgtactt
gaatccacggggcaaggcatgctcaagggcatgctgccaccgatatag

DBGET integrated database retrieval system