KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1423Help
Entry
Ddes_1423         CDS       T00837                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
dds00010  Glycolysis / Gluconeogenesis
dds00030  Pentose phosphate pathway
dds00051  Fructose and mannose metabolism
dds00052  Galactose metabolism
dds00680  Methane metabolism
dds01100  Metabolic pathways
dds01110  Biosynthesis of secondary metabolites
dds01120  Microbial metabolism in diverse environments
dds01130  Biosynthesis of antibiotics
dds01200  Carbon metabolism
dds01230  Biosynthesis of amino acids
dds03018  RNA degradation
Module
dds_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ddes_1423
   00030 Pentose phosphate pathway
    Ddes_1423
   00051 Fructose and mannose metabolism
    Ddes_1423
   00052 Galactose metabolism
    Ddes_1423
  Energy metabolism
   00680 Methane metabolism
    Ddes_1423
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ddes_1423
Enzymes [BR:dds01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ddes_1423
Protein phosphatases and associated proteins [BR:dds01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ddes_1423
Messenger RNA biogenesis [BR:dds03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Ddes_1423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACL49325
JGI: Ddes1423
UniProt: B8J0P8
Position
1702022..1703329
Genome map
AA seq 435 aa AA seqDB search
MNKECTLQTDIRTLGPCKLDSHLPYRTWADDRTVQIFVDEDLTDDAGKAFSVCLEAAGPR
KKLYFDSTRAKCAIVTCGGLCPGINDVIRAIVMEAFHAYNVPSILGIPYGLEGFIPKYGH
TLQELTPKGVADIHRFGGTMLGSSRGPQSAEEIVDALERSNVNILFVIGGDGTMKAARAI
STEIQARNLKLAVIGIPKTIDNDINFIPQSFGFETAVYKATEAIECAHTEACGVPNGIGL
VKLMGRESGFIAARAALALKEVNFVLIPEAPFSLEGEGGLLPALEERLKARGHAVIVAAE
GAGQHLLAEQNGTDASGNPVLGDISELLRTSINTYLDTRGVAHSIKYIDPSYIIRSIPAS
ANDKVYCGFLGQYAVHAAMAGRTHMVVGKIQDRYVHLPLELVTRKRRKLNIYSDLWRAVL
ESTGQGMLKGMLPPI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagaatgtactctgcaaacggatatacgcacccttggtccctgcaagctcgat
tcccacctgccctatcgcacctgggccgatgacaggaccgtacagatttttgtggatgaa
gatctgacagacgacgccggcaaggcctttagcgtatgcctcgaggccgccgggccacgc
aaaaagctctactttgactccacgcgggccaaatgcgccatcgtgacctgcggcggcctt
tgccccggcatcaacgatgtcatacgggccatcgtaatggaggcctttcatgcgtacaac
gtgccgtccatcctgggtattccttacggtcttgaaggctttatccccaagtacggtcac
accctccaggaactgacgcccaaaggcgtggctgacatccatcgctttggcggaaccatg
ctcgggtcttcacgcgggccgcagtccgccgaggaaattgtggacgcccttgaacgcagc
aatgtcaatattctttttgtgatcggcggcgacgggactatgaaggccgcgcgggccatc
agtacagaaattcaggcccgcaacctgaaacttgccgttatcggcattcccaaaaccatt
gataatgacatcaacttcattccccagtccttcggctttgaaaccgctgtctacaaggcc
acagaagccattgaatgcgcccacaccgaagcgtgcggcgttcccaacggcattgggctg
gtgaagcttatggggcgcgaatcgggttttatcgccgcccgggccgcgctggcgctcaag
gaagtaaactttgtgctcattcccgaagcgccattcagccttgaaggtgaaggggggctt
ctgcctgctctggaagaacgcctgaaagcgcggggacatgccgtcatcgttgccgccgaa
ggggccgggcaacatttgcttgcggaacagaacggcaccgatgcctccggcaatcccgtg
ctcggcgacatctccgaactcctgcgcacgtccatcaacacctatctggacacacgtggc
gtggctcactccataaaatatatcgacccgagctatatcatccgctccattcccgccagc
gccaacgacaaggtttactgcggctttctgggccagtacgcggtgcacgccgccatggcg
ggtcgcacacatatggtggtggggaaaattcaggaccgctacgtgcacctgccgctggaa
ctggtcacgcgcaagcgccgcaaactcaatatctattccgacctgtggcgggccgtactt
gaatccacggggcaaggcatgctcaagggcatgctgccaccgatatag

DBGET integrated database retrieval system