KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1450Help
Entry
Ddes_1450         CDS       T00837                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ddes_1450
Enzymes [BR:dds01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Ddes_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1738034..1738921
Genome map
AA seq 295 aa AA seqDB search
MSILTAGCKVNLGLRITGVRPDGYHEIDSLFYPLPRPCDQIKLRVTDVSGISVLCTGPEA
GLLDAENNTLTRAYTAFAQAVDFPVPGLEARLRKGIPSGAGLGGGSSDAAALLRWLNGHV
ATPLSSQSLAEVALGVGADVPFFLHNCPCRVRGIGEIIESVDLDVSGMRLVLVCPEIHVS
TPQTFADYDAFAAASHAAEKQNSLTREQSRANGTFLSQGRFDADLGNDLESVVFRRHPEL
ADIKATLLRYGATAACMSGSGSSILGLFRREALVEAQAAVAMLQGENRRVYAHVL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagcattctcaccgccggttgcaaggtaaatctgggcttgcgcatcaccggggttcgc
cccgacggctatcacgaaatcgactctctgttctaccccttgccacgcccctgtgatcag
ataaagctgcgcgtcactgacgtcagtggtatttccgtgctctgcacagggccggaggcc
gggctgctggatgcggaaaacaatacccttaccagggcctacacagcctttgcccaggca
gtggatttccctgttcccggccttgaagcgcgtttgcgcaagggtattccttccggggcc
ggtcttggcggcggcagcagcgatgcggcagccctgctgcgctggcttaacgggcatgtt
gccacaccgctctcgtcacagtctctggcagaggtagcccttggtgtgggggccgatgtg
cctttttttttgcacaattgcccctgccgtgtgcgcggcataggggaaattatcgaatct
gttgacctggatgtttcaggcatgcgtctggtgctcgtatgcccggaaatccatgtaagc
acgccacaaacctttgctgattacgatgcttttgcggctgcctcccacgctgccgaaaag
caaaacagcttgacaagagagcaaagcagggctaatggaacttttctctcccaagggcgg
tttgacgctgacttgggcaacgatctagaaagcgttgtcttcagacgtcatcccgagctg
gccgacatcaaggccaccctgctgcgctacggggcaacagcggcttgcatgagcggcagc
ggctccagcatactggggcttttcaggcgcgaagcgcttgtggaagcacaggctgccgtt
gccatgctgcaaggagagaacaggcgcgtttacgcgcatgtgctgtga

DBGET integrated database retrieval system