KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1450Help
Entry
Ddes_1450         CDS       T00837                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:dds00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1738034..1738921
Genome map
AA seq 295 aa AA seqDB search
MSILTAGCKVNLGLRITGVRPDGYHEIDSLFYPLPRPCDQIKLRVTDVSGISVLCTGPEA
GLLDAENNTLTRAYTAFAQAVDFPVPGLEARLRKGIPSGAGLGGGSSDAAALLRWLNGHV
ATPLSSQSLAEVALGVGADVPFFLHNCPCRVRGIGEIIESVDLDVSGMRLVLVCPEIHVS
TPQTFADYDAFAAASHAAEKQNSLTREQSRANGTFLSQGRFDADLGNDLESVVFRRHPEL
ADIKATLLRYGATAACMSGSGSSILGLFRREALVEAQAAVAMLQGENRRVYAHVL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagcattctcaccgccggttgcaaggtaaatctgggcttgcgcatcaccggggttcgc
cccgacggctatcacgaaatcgactctctgttctaccccttgccacgcccctgtgatcag
ataaagctgcgcgtcactgacgtcagtggtatttccgtgctctgcacagggccggaggcc
gggctgctggatgcggaaaacaatacccttaccagggcctacacagcctttgcccaggca
gtggatttccctgttcccggccttgaagcgcgtttgcgcaagggtattccttccggggcc
ggtcttggcggcggcagcagcgatgcggcagccctgctgcgctggcttaacgggcatgtt
gccacaccgctctcgtcacagtctctggcagaggtagcccttggtgtgggggccgatgtg
cctttttttttgcacaattgcccctgccgtgtgcgcggcataggggaaattatcgaatct
gttgacctggatgtttcaggcatgcgtctggtgctcgtatgcccggaaatccatgtaagc
acgccacaaacctttgctgattacgatgcttttgcggctgcctcccacgctgccgaaaag
caaaacagcttgacaagagagcaaagcagggctaatggaacttttctctcccaagggcgg
tttgacgctgacttgggcaacgatctagaaagcgttgtcttcagacgtcatcccgagctg
gccgacatcaaggccaccctgctgcgctacggggcaacagcggcttgcatgagcggcagc
ggctccagcatactggggcttttcaggcgcgaagcgcttgtggaagcacaggctgccgtt
gccatgctgcaaggagagaacaggcgcgtttacgcgcatgtgctgtga

DBGET integrated database retrieval system