KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1514Help
Entry
Ddes_1514         CDS       T00837                                 

Definition
transport system permease
Orthology
K02015  
iron complex transport system permease protein
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:dds00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Ddes_1514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1806963..1807970)
Genome map
AA seq 335 aa AA seqDB search
MAHSRKTLLVLALLLLAAIVFALPMGRYPLPLGDLCRSLLDAWAGRPLDDEQRRHLFLFF
DLRLPRIGSALLVGACLSASGTVYQNMFQNPLVSPGILGVQHGAAFGAAIGIVFFSSWPL
TQAFSFAGGTLGVGLSLFFAWLYPRARFLALVVGGLVSSSFFVALTSLVQYVADPNRQLP
ELVYWLMGTLSRTEPHQLAWSAPLMLAGLVYICLNGKAVNALAMGDDEARTLGVQSTGMK
LRLIGAATLVCSLTVVLAGVINWVGLVIPHVMRFIVGPDNRVGLTASAMGGALFVLLTDT
LIRSVWTVELPLGIATSLISMPLFAFSLWYDWKRR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcacattctagaaaaaccctgctcgtgcttgccctgcttttgctggcggcaattgtg
tttgccctgcccatgggccgctatccgctgcccctgggtgatctttgccgcagtctgctg
gatgcctgggcggggcggcctctggatgacgagcagcgcaggcacctttttctgtttttt
gacctgcgtctgccgcgtatcggttcagccctgctggtgggggcctgcctgtccgcttcg
ggtacggtataccagaacatgtttcagaatcctcttgtgtcgccgggcatactgggtgtg
cagcacggagctgcatttggcgcggccataggtattgtgtttttttcttcctggccgctg
acacaggctttttccttcgcgggcggcacgctgggcgtggggctgtctctcttttttgca
tggctctaccccagggcgcgttttttggcgcttgtggtgggcggccttgtaagcagttca
ttttttgtggctctgacttctcttgtgcagtatgtggccgaccccaaccgccagctgccg
gagcttgtgtactggcttatggggacgctgtcccgcacggagccgcatcaactggcctgg
agcgcacctctcatgctggccggcctggtctatatctgcctcaacggcaaagcggtaaac
gctcttgctatgggggacgatgaggcccgtacactgggagtacagagcacgggcatgaaa
ttgcgccttatcggggccgcaacacttgtctgctcgcttacggtggtgcttgcaggggtc
atcaactgggtcgggctggtcattccgcatgtcatgcgtttcatagtcgggccggacaac
agggtggggcttacagcatcagccatgggcggcgcgctttttgtgctgcttacagacacg
ctcatacgttctgtctggacagtggaacttccattgggcattgccacatcactcatcagc
atgccgctttttgccttcagcctgtggtacgactggaaacggcgatga

DBGET integrated database retrieval system