KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1588Help
Entry
Ddes_1588         CDS       T00837                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
dds00260  Glycine, serine and threonine metabolism
dds00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dds01100  Metabolic pathways
dds01110  Biosynthesis of secondary metabolites
dds01130  Biosynthesis of antibiotics
dds01230  Biosynthesis of amino acids
Module
dds_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ddes_1588
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ddes_1588
Enzymes [BR:dds01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ddes_1588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACL49488
JGI: Ddes1588
UniProt: B8J161
Position
complement(1908906..1910096)
Genome map
AA seq 396 aa AA seqDB search
MKNRYFGEFGGCFVPELLMPPLMEVEAAMHDIYPTEAFQAELESLLRNYAGRETPLTHCP
TLSRELGFDLWLKREDLLHTGAHKINNTLGQALLARHMGKTALVAETGAGQHGVATAASA
ARLGMECTIYMGAEDVERQAPNVMRMKLLGATVHAVESGTRTLKDAINEALRAWIGSQKT
THYCFGTAAGPHPFPLLVRELQSVIGRETRAQMLGKTGRLPDAIVACVGGGSNAIGMFYP
FLDDAAVRIVGVEAAGTGEPGCFNSAPLNLGVPGVLHGAYSMLLQNDDGQVEPSHSISAG
LDYPGVGPEHSWLHKTGRVHYGMVKDGNALAAFQRLCRAEGILPALESSHALAWVLDHPH
EFKPGQQVVVNLSGRGDKDLGIINKALGFALGQDEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacagatattttggtgaattcggcggctgctttgtgcccgaattgctcatgccg
ccgcttatggaggtcgaggcggccatgcacgacatttatcccacagaggcctttcaggct
gaactggaaagcctcctgcgcaattatgccgggcgtgagacaccgctgacccattgcccg
accctgtcgcgggaactgggctttgacctctggctcaagcgtgaggacctgttgcataca
ggggcgcacaagatcaacaataccctggggcaggcgctgcttgccaggcatatgggcaag
acggccctggtggctgaaaccggagccgggcagcacggtgttgccaccgcggcctccgcg
gcccgcctgggtatggaatgcaccatttatatgggtgcggaagatgtggagcggcaagcc
cccaacgtcatgcgcatgaagctgctcggggccaccgtgcacgcggtggaaagcggtacg
cgcaccctcaaggatgccattaacgaagccctgcgcgcctggataggcagccagaaaaca
actcattactgctttggaacagctgcagggccacatccttttccgctgttggtgcgtgag
ctgcaaagcgtcatagggcgcgaaacacgcgcccagatgctgggaaaaaccggcaggctg
cctgatgccatagtggcttgcgtgggcggcgggtccaatgccatcggcatgttttatcct
tttctcgacgatgccgcagtgcgcattgtgggcgtagaggcagcaggtaccggcgagccg
ggctgcttcaactccgcgccgctcaacctcggcgttcccggtgtgctgcacggcgcgtac
agcatgcttttgcagaatgatgacggccaggtggagccttcacattccatttccgccggt
ctggattatccgggcgttggtcccgagcactcctggctgcacaaaacgggccgcgtccac
tacggcatggttaaagacggcaacgcacttgcggcctttcagcgactatgccgcgccgag
ggcatcctgcctgccctggaatcttcacatgcgctggcctgggtgctggatcatccgcat
gagttcaagcccggccagcaggtggtggtcaacctttcgggccgcggtgacaaggatctt
ggcattatcaacaaggccctgggttttgccctggggcaggacgaggtgtag

DBGET integrated database retrieval system