KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1588Help
Entry
Ddes_1588         CDS       T00837                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ddes_1588
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ddes_1588
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ddes_1588
Enzymes [BR:dds01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ddes_1588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1908906..1910096)
Genome map
AA seq 396 aa AA seqDB search
MKNRYFGEFGGCFVPELLMPPLMEVEAAMHDIYPTEAFQAELESLLRNYAGRETPLTHCP
TLSRELGFDLWLKREDLLHTGAHKINNTLGQALLARHMGKTALVAETGAGQHGVATAASA
ARLGMECTIYMGAEDVERQAPNVMRMKLLGATVHAVESGTRTLKDAINEALRAWIGSQKT
THYCFGTAAGPHPFPLLVRELQSVIGRETRAQMLGKTGRLPDAIVACVGGGSNAIGMFYP
FLDDAAVRIVGVEAAGTGEPGCFNSAPLNLGVPGVLHGAYSMLLQNDDGQVEPSHSISAG
LDYPGVGPEHSWLHKTGRVHYGMVKDGNALAAFQRLCRAEGILPALESSHALAWVLDHPH
EFKPGQQVVVNLSGRGDKDLGIINKALGFALGQDEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacagatattttggtgaattcggcggctgctttgtgcccgaattgctcatgccg
ccgcttatggaggtcgaggcggccatgcacgacatttatcccacagaggcctttcaggct
gaactggaaagcctcctgcgcaattatgccgggcgtgagacaccgctgacccattgcccg
accctgtcgcgggaactgggctttgacctctggctcaagcgtgaggacctgttgcataca
ggggcgcacaagatcaacaataccctggggcaggcgctgcttgccaggcatatgggcaag
acggccctggtggctgaaaccggagccgggcagcacggtgttgccaccgcggcctccgcg
gcccgcctgggtatggaatgcaccatttatatgggtgcggaagatgtggagcggcaagcc
cccaacgtcatgcgcatgaagctgctcggggccaccgtgcacgcggtggaaagcggtacg
cgcaccctcaaggatgccattaacgaagccctgcgcgcctggataggcagccagaaaaca
actcattactgctttggaacagctgcagggccacatccttttccgctgttggtgcgtgag
ctgcaaagcgtcatagggcgcgaaacacgcgcccagatgctgggaaaaaccggcaggctg
cctgatgccatagtggcttgcgtgggcggcgggtccaatgccatcggcatgttttatcct
tttctcgacgatgccgcagtgcgcattgtgggcgtagaggcagcaggtaccggcgagccg
ggctgcttcaactccgcgccgctcaacctcggcgttcccggtgtgctgcacggcgcgtac
agcatgcttttgcagaatgatgacggccaggtggagccttcacattccatttccgccggt
ctggattatccgggcgttggtcccgagcactcctggctgcacaaaacgggccgcgtccac
tacggcatggttaaagacggcaacgcacttgcggcctttcagcgactatgccgcgccgag
ggcatcctgcctgccctggaatcttcacatgcgctggcctgggtgctggatcatccgcat
gagttcaagcccggccagcaggtggtggtcaacctttcgggccgcggtgacaaggatctt
ggcattatcaacaaggccctgggttttgccctggggcaggacgaggtgtag

DBGET integrated database retrieval system