KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1673Help
Entry
Ddes_1673         CDS       T00837                                 

Definition
NADH dehydrogenase (quinone) (EC:1.6.99.5)
Orthology
K14086  
ech hydrogenase subunit A
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2009193..2011148)
Genome map
AA seq 651 aa AA seqDB search
MNTLVFCCVALPFAVALVLYFTQLDRTRKLLVPAAVAVMALAAVIMGAHGTFRLEAETFM
GLPLDSLFSLLDLLLLLYILGLGWKLGSRTVMGMTVLQLIGLLYLKFVLADGSAPITAFA
PDGLSLIMVIIITVVGGLITIYGLGYMDIHEEHLHLRVSRKPRFFAIIFCFLGAMNGLVL
SNNLSWMFFFWEVTTLCSYLLISHDQTQEANANAYRALWMNVLGGLAFVSAMLFIQKSLG
TLSTEVVLHKMTAMDVKTTAMLLPFAFFCLAAFTKSAQVPFESWLCGAMVAPTPVSALLH
SATMVKAGTYLLLRMAPAFADTTMSTIVALFGAFTFVGTCILAVSQSNAKKILAYSTIAN
LGLIIACVGINTAASMMAATTIIIYHSVSKGLLFMCVGAIEQRIGSRDIEDMRGLYSKMP
RTAIITAIGIFTMMLPPFGMLIGKWMAIEAIARATQAMTPIIFFIALGSAFTVLFWARWA
GILVSSANLHDRPPHGNPKATVMFALRSLCGLAVVFSFISPLVLETFVEPSVAGVYARLG
LKTEGFIPGASLTGGAGYFWIYLLFILLGLGAWIAWKAARKVSNSAHAQPYFSGLTQEQA
GQIGFKGPMNAFEPVRLSNFYLTQYFGEGTITRAIDIISTAFLIVLVGGLL
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgaatacacttgttttttgctgtgtggcgctgccatttgctgtggcgcttgttctgtat
ttcacacagcttgaccgcacccgcaagcttctcgtgcctgcagcggttgcggtgatggct
ctggctgccgtgattatgggtgctcacggaacgttccgacttgaggccgaaactttcatg
ggccttccgctggacagcctgttcagcttgctggatcttttgctgctgctctatattttg
ggcttgggctggaagctgggcagccgcacggtcatgggcatgactgtgctgcaattgatt
gggttgctttacctcaagtttgttctggcggacggttccgcccccattactgcctttgcg
cccgatggcctgtcgctcatcatggttatcataatcaccgtggtgggtggcctgatcacc
atttacggcctgggctatatggatattcatgaagagcacctgcacctgcgggtttctcgc
aaaccgcggtttttcgccattattttctgctttctcggggcgatgaacgggcttgtgctt
tcaaacaatctttcgtggatgttctttttctgggaagtcacgaccctgtgttcctacctg
ctgatcagccacgatcagacacaggaagccaatgccaacgcctaccgtgcattgtggatg
aacgttcttggcggtcttgcctttgtttctgccatgcttttcattcagaagagccttggc
acactgtccactgaagttgtattgcacaagatgacggccatggacgtgaaaaccacggcc
atgctgctgccgtttgcctttttttgcctggcggcctttaccaagtcggcgcaggttccc
tttgaaagctggctgtgcggtgccatggttgctcccaccccggtttcggccctgctgcac
tcggccaccatggtcaaggcgggcacatacctgctgctgcgcatggccccggccttcgct
gacaccaccatgtccaccattgtggcgctcttcggcgcgttcacctttgtggggacatgc
attctggcggtcagccaaagtaatgccaaaaagatcctggcatactcaaccattgccaac
ctggggcttatcatcgcctgcgttggcataaatacggcggcatccatgatggcggccacc
accatcatcatctaccactcggtctccaagggcctgctcttcatgtgcgtgggcgccatt
gaacagcgcatcggctccagagatattgaagacatgcgcggcctgtacagcaagatgccc
cgcacggccattattacggccataggcatcttcaccatgatgctgccgcctttcggcatg
ctcataggcaagtggatggcaattgaggccattgcccgtgccacccaggccatgacgccc
atcattttcttcattgccctcggctcggcctttactgtgctgttctgggcgcggtgggca
ggcatactcgtatcttcggccaacctgcatgaccggccccctcacggcaaccccaaggcc
acggtcatgtttgccctgcgttcgctctgcgggcttgccgtggtgttctccttcatttcg
cctctggtactggaaacatttgtcgagccttctgtggctggcgtatacgcccgccttggt
ctcaagaccgaaggcttcatacctggcgcatcgcttacaggtggggcgggctatttctgg
atttacctgctcttcatcctgcttggcctgggggcctggattgcctggaaggccgccaga
aaggtttcaaactcggcgcatgcccagccctatttctcggggctgacgcaggaacaggcg
gggcagatcggtttcaagggccccatgaatgcctttgaacccgtgcgtctgtccaacttt
tacctgacccagtactttggcgaaggcactataacacgggccattgatattatatccacg
gcctttctcatcgtcctggtaggaggtctgctctaa

DBGET integrated database retrieval system