KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1712Help
Entry
Ddes_1712         CDS       T00837                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
dds00040  Pentose and glucuronate interconversions
dds00052  Galactose metabolism
dds00500  Starch and sucrose metabolism
dds00520  Amino sugar and nucleotide sugar metabolism
dds01100  Metabolic pathways
dds01130  Biosynthesis of antibiotics
Module
dds_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ddes_1712
   00052 Galactose metabolism
    Ddes_1712
   00500 Starch and sucrose metabolism
    Ddes_1712
   00520 Amino sugar and nucleotide sugar metabolism
    Ddes_1712
Enzymes [BR:dds01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ddes_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACL49610
JGI: Ddes1712
UniProt: B8J1K2
Position
complement(2070797..2071669)
Genome map
AA seq 290 aa AA seqDB search
MKDIRKVIIPVAGWGTRSLPATKNIPKEMLPIYNKPVIQYVVEEAQKANIQDVIFVTNRD
KSVIEDHFDYNLQLEAVLERAGKLDKLQEVRKVAEMVNIMSVRQKKQLGLGHAVLCAREL
VRDDPFAVMVGDDLMFGGVPGIAQLIDVAMAEKMPVIGVMEVPWEKVDRYGIIEGDEVAP
GVFRVKSMVEKPARDKAPSRMAIVGRYVLTPDIFDYLEKVTPGHGGEIQLTDALQAMAQD
RGMMAVRMSGMRFDAGDWAEFLTANIYFALQDEELRYDLLNLLKNFVQFH
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatattcgcaaggttattattcccgtggccggatggggtacgcgttcattaccc
gcgaccaagaatattcccaaggaaatgctgcccatctacaacaagccggtcatccagtat
gtggtggaagaggcccagaaggccaatatccaggacgttatttttgtaaccaaccgcgac
aaaagcgtcattgaagaccactttgactataacctgcaactggaagctgtgcttgaacgc
gccggaaagctcgacaagctgcaagaagtgcgcaaggtagcggaaatggtcaacatcatg
tccgtgcgccagaaaaaacagctcggtctcgggcatgccgtgctgtgtgcgcgtgaactg
gtacgggacgatccttttgccgttatggtgggtgatgacctgatgtttggcggtgttccc
ggcattgcccagcttattgacgtggccatggctgaaaagatgcccgtcatcggcgttatg
gaagtgccatgggaaaaggtagaccgttacggcatcattgaaggggacgaagttgctccc
ggagtattcagggtcaagagtatggtggaaaagcccgcccgtgacaaggccccctcgcgc
atggctattgtgggccgttatgtgcttacacccgatatttttgactatcttgaaaaagtc
actccagggcacggcggcgaaattcaactgactgacgctcttcaggccatggcgcaggac
aggggcatgatggcggtgcgcatgtcgggcatgcgttttgacgccggagactgggcggaa
tttttgacggccaatatctattttgccctgcaggacgaagaattgcgctatgatttgttg
aatttgctcaagaattttgtgcaattccactag

DBGET integrated database retrieval system