KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1712Help
Entry
Ddes_1712         CDS       T00837                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ddes_1712
   00052 Galactose metabolism
    Ddes_1712
   00500 Starch and sucrose metabolism
    Ddes_1712
   00520 Amino sugar and nucleotide sugar metabolism
    Ddes_1712
Enzymes [BR:dds01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ddes_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2070797..2071669)
Genome map
AA seq 290 aa AA seqDB search
MKDIRKVIIPVAGWGTRSLPATKNIPKEMLPIYNKPVIQYVVEEAQKANIQDVIFVTNRD
KSVIEDHFDYNLQLEAVLERAGKLDKLQEVRKVAEMVNIMSVRQKKQLGLGHAVLCAREL
VRDDPFAVMVGDDLMFGGVPGIAQLIDVAMAEKMPVIGVMEVPWEKVDRYGIIEGDEVAP
GVFRVKSMVEKPARDKAPSRMAIVGRYVLTPDIFDYLEKVTPGHGGEIQLTDALQAMAQD
RGMMAVRMSGMRFDAGDWAEFLTANIYFALQDEELRYDLLNLLKNFVQFH
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatattcgcaaggttattattcccgtggccggatggggtacgcgttcattaccc
gcgaccaagaatattcccaaggaaatgctgcccatctacaacaagccggtcatccagtat
gtggtggaagaggcccagaaggccaatatccaggacgttatttttgtaaccaaccgcgac
aaaagcgtcattgaagaccactttgactataacctgcaactggaagctgtgcttgaacgc
gccggaaagctcgacaagctgcaagaagtgcgcaaggtagcggaaatggtcaacatcatg
tccgtgcgccagaaaaaacagctcggtctcgggcatgccgtgctgtgtgcgcgtgaactg
gtacgggacgatccttttgccgttatggtgggtgatgacctgatgtttggcggtgttccc
ggcattgcccagcttattgacgtggccatggctgaaaagatgcccgtcatcggcgttatg
gaagtgccatgggaaaaggtagaccgttacggcatcattgaaggggacgaagttgctccc
ggagtattcagggtcaagagtatggtggaaaagcccgcccgtgacaaggccccctcgcgc
atggctattgtgggccgttatgtgcttacacccgatatttttgactatcttgaaaaagtc
actccagggcacggcggcgaaattcaactgactgacgctcttcaggccatggcgcaggac
aggggcatgatggcggtgcgcatgtcgggcatgcgttttgacgccggagactgggcggaa
tttttgacggccaatatctattttgccctgcaggacgaagaattgcgctatgatttgttg
aatttgctcaagaattttgtgcaattccactag

DBGET integrated database retrieval system