KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1748Help
Entry
Ddes_1748         CDS       T00837                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
dds00010  Glycolysis / Gluconeogenesis
dds00620  Pyruvate metabolism
dds00640  Propanoate metabolism
dds00680  Methane metabolism
dds01100  Metabolic pathways
dds01110  Biosynthesis of secondary metabolites
dds01120  Microbial metabolism in diverse environments
dds01130  Biosynthesis of antibiotics
dds01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ddes_1748
   00620 Pyruvate metabolism
    Ddes_1748
   00640 Propanoate metabolism
    Ddes_1748
  Energy metabolism
   00680 Methane metabolism
    Ddes_1748
Enzymes [BR:dds01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ddes_1748
Lipid biosynthesis proteins [BR:dds01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ddes_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACL49646
JGI: Ddes1748
UniProt: B8J1N8
Position
2114466..2116514
Genome map
AA seq 682 aa AA seqDB search
MSQERITTLLNENRSYLPPEHGKTSAWVCGPEEYNALCRRALEDPNDFWGARASQLIHWF
KRWDKVLEADEANHKYQWFTGGKLNASFNCIDRHLISGRRNKAALIWQGEKETDVRCYTY
QMLYTEVCRVAHAMSSLRIRKGDHVALYMPMIPELFIAMLACARIGAIHTAIFSGYAEGG
VRSRIQGCKARVVITADAAVRGGKFKPLKANLDPILEKCPSVAHVVVVKHAGLENVNMQR
NRDIWWHDLIDDFTLNPDFPCEPMDANDTLFLLHTSGSTGKPTGVMHSTGGYLTYAAHTT
QWCFDMRDDDVYWCTADAGWITGHTYGVYGPLALGATTLMFEGIPTWPYPDRYWRIVENF
RVNILYTAPTVVRSLMRMNEAWTERYDLRSLRILGSVGEPINPEAWHWYHKHIGGSELPI
VDTWWQTETGGAMIAPMPYATKLKPGSASKPLPGIDATVMGSAARDGEEPEAGCKAGHLV
IRRPWPGMMQGVFNDEEKYQSYFSRFGCYSSGDAAEIDQDGYFWILGRIDDSINVSGHRL
STAEIEAVLAACPEVGEAAVVPMPHALKGEGIYVYVVTRDEVPWSADLRAKLREAVRRDI
GALATPEYIQFVEGMPKTTSGKIIRRMLRKIAGDSYEDIGDTTSLAEPDVIPKIISGHRN
LMAGRHEMEDAPEGENGAKTDA
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggaacggatcactacactgttgaatgaaaatcgcagctatcttccaccagag
cacggcaagacgtctgcctgggtttgcggtccggaagagtataatgcactatgccgccgc
gctctggaagaccccaatgacttttggggagcgcgagcatcgcagttgatccattggttc
aaacgctgggacaaagtattggaagctgacgaagcaaaccataaataccagtggtttacc
ggtggaaaactcaatgcttcctttaactgcatcgacagacatctgatttcgggcagacgc
aacaaggccgcccttatctggcaaggcgaaaaagaaacagatgtgcgctgctacacttat
cagatgctttatacagaggtctgccgcgtagcgcatgccatgagttcactgcgcattcgc
aaaggcgaccatgttgccctgtatatgccaatgatacctgagctttttattgccatgctg
gcctgcgcccgcataggcgccatacacacggccatcttttccggctatgcggaagggggc
gtgcgcagccgcatacagggttgcaaggcccgcgtggtcatcacggccgatgcggcagtg
cgcggtggcaagttcaaacccctcaaggccaaccttgaccccatcctggaaaaatgtcct
tcggtggcccacgtggtggtcgtcaagcatgcggggcttgaaaacgtcaacatgcaacgc
aaccgcgatatctggtggcacgaccttattgacgattttacccttaaccccgactttccc
tgcgaaccaatggatgccaatgacacgcttttcctgctgcacaccagcggcagtacgggc
aagcccaccggggtaatgcattccactggcggctacctgacctatgcggcccacaccacc
cagtggtgctttgacatgcgcgatgacgatgtgtactggtgcacggccgatgccggatgg
attaccggccatacctacggtgtgtatggcccgcttgccctgggtgccaccacgctcatg
tttgaaggcatacccacatggccctaccccgacagatactggcgcatcgtggaaaacttc
cgcgtcaatatcctctatacagcgcccacggttgtccgctccctcatgcggatgaacgag
gcgtggacagaacgttacgacctgcgcagcctgcgtatcctgggcagcgtgggcgaaccc
atcaatcccgaagcctggcactggtaccacaagcacatcggcggcagtgaactgcccata
gtggacacgtggtggcagacggaaaccggcggagccatgatcgcccccatgccctacgcc
acaaagctcaaacccggctccgcctcaaagccgctgcccggtattgacgccaccgttatg
gggtcggccgcgcgcgacggcgaagaacccgaagcaggctgcaaggcgggccatcttgtc
attcgccgcccctggccgggcatgatgcagggcgtcttcaatgatgaagagaagtaccag
tcctatttttcgcgcttcggctgctattcttcgggcgacgccgccgaaatcgaccaggac
ggctacttctggatactcggccgtattgacgactccatcaacgtttccggccatcgcctt
tccaccgccgaaatagaagccgtgctggccgcctgccccgaggtgggcgaagcggctgtg
gttcccatgccccacgcccttaaaggcgaaggtatctatgtatacgtggtcacgcgcgat
gaggttccctggagtgcggacctgcgcgccaaactgcgcgaggccgtgcgcagggatatc
ggcgctctggcaacgccggaatacatacaattcgtggagggcatgcccaagaccacatcc
ggcaagatcatacgccgcatgctgcgaaaaatagccggagacagctacgaagatatcggt
gataccacatcgctggccgaacccgatgtcatacccaaaatcatctccgggcaccgcaac
ctcatggccggacgtcatgaaatggaagacgcccccgaaggggaaaatggcgccaaaaca
gacgcctga

DBGET integrated database retrieval system