KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1748Help
Entry
Ddes_1748         CDS       T00837                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dds01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dds00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dds00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dds00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:dds00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2114466..2116514
Genome map
AA seq 682 aa AA seqDB search
MSQERITTLLNENRSYLPPEHGKTSAWVCGPEEYNALCRRALEDPNDFWGARASQLIHWF
KRWDKVLEADEANHKYQWFTGGKLNASFNCIDRHLISGRRNKAALIWQGEKETDVRCYTY
QMLYTEVCRVAHAMSSLRIRKGDHVALYMPMIPELFIAMLACARIGAIHTAIFSGYAEGG
VRSRIQGCKARVVITADAAVRGGKFKPLKANLDPILEKCPSVAHVVVVKHAGLENVNMQR
NRDIWWHDLIDDFTLNPDFPCEPMDANDTLFLLHTSGSTGKPTGVMHSTGGYLTYAAHTT
QWCFDMRDDDVYWCTADAGWITGHTYGVYGPLALGATTLMFEGIPTWPYPDRYWRIVENF
RVNILYTAPTVVRSLMRMNEAWTERYDLRSLRILGSVGEPINPEAWHWYHKHIGGSELPI
VDTWWQTETGGAMIAPMPYATKLKPGSASKPLPGIDATVMGSAARDGEEPEAGCKAGHLV
IRRPWPGMMQGVFNDEEKYQSYFSRFGCYSSGDAAEIDQDGYFWILGRIDDSINVSGHRL
STAEIEAVLAACPEVGEAAVVPMPHALKGEGIYVYVVTRDEVPWSADLRAKLREAVRRDI
GALATPEYIQFVEGMPKTTSGKIIRRMLRKIAGDSYEDIGDTTSLAEPDVIPKIISGHRN
LMAGRHEMEDAPEGENGAKTDA
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggaacggatcactacactgttgaatgaaaatcgcagctatcttccaccagag
cacggcaagacgtctgcctgggtttgcggtccggaagagtataatgcactatgccgccgc
gctctggaagaccccaatgacttttggggagcgcgagcatcgcagttgatccattggttc
aaacgctgggacaaagtattggaagctgacgaagcaaaccataaataccagtggtttacc
ggtggaaaactcaatgcttcctttaactgcatcgacagacatctgatttcgggcagacgc
aacaaggccgcccttatctggcaaggcgaaaaagaaacagatgtgcgctgctacacttat
cagatgctttatacagaggtctgccgcgtagcgcatgccatgagttcactgcgcattcgc
aaaggcgaccatgttgccctgtatatgccaatgatacctgagctttttattgccatgctg
gcctgcgcccgcataggcgccatacacacggccatcttttccggctatgcggaagggggc
gtgcgcagccgcatacagggttgcaaggcccgcgtggtcatcacggccgatgcggcagtg
cgcggtggcaagttcaaacccctcaaggccaaccttgaccccatcctggaaaaatgtcct
tcggtggcccacgtggtggtcgtcaagcatgcggggcttgaaaacgtcaacatgcaacgc
aaccgcgatatctggtggcacgaccttattgacgattttacccttaaccccgactttccc
tgcgaaccaatggatgccaatgacacgcttttcctgctgcacaccagcggcagtacgggc
aagcccaccggggtaatgcattccactggcggctacctgacctatgcggcccacaccacc
cagtggtgctttgacatgcgcgatgacgatgtgtactggtgcacggccgatgccggatgg
attaccggccatacctacggtgtgtatggcccgcttgccctgggtgccaccacgctcatg
tttgaaggcatacccacatggccctaccccgacagatactggcgcatcgtggaaaacttc
cgcgtcaatatcctctatacagcgcccacggttgtccgctccctcatgcggatgaacgag
gcgtggacagaacgttacgacctgcgcagcctgcgtatcctgggcagcgtgggcgaaccc
atcaatcccgaagcctggcactggtaccacaagcacatcggcggcagtgaactgcccata
gtggacacgtggtggcagacggaaaccggcggagccatgatcgcccccatgccctacgcc
acaaagctcaaacccggctccgcctcaaagccgctgcccggtattgacgccaccgttatg
gggtcggccgcgcgcgacggcgaagaacccgaagcaggctgcaaggcgggccatcttgtc
attcgccgcccctggccgggcatgatgcagggcgtcttcaatgatgaagagaagtaccag
tcctatttttcgcgcttcggctgctattcttcgggcgacgccgccgaaatcgaccaggac
ggctacttctggatactcggccgtattgacgactccatcaacgtttccggccatcgcctt
tccaccgccgaaatagaagccgtgctggccgcctgccccgaggtgggcgaagcggctgtg
gttcccatgccccacgcccttaaaggcgaaggtatctatgtatacgtggtcacgcgcgat
gaggttccctggagtgcggacctgcgcgccaaactgcgcgaggccgtgcgcagggatatc
ggcgctctggcaacgccggaatacatacaattcgtggagggcatgcccaagaccacatcc
ggcaagatcatacgccgcatgctgcgaaaaatagccggagacagctacgaagatatcggt
gataccacatcgctggccgaacccgatgtcatacccaaaatcatctccgggcaccgcaac
ctcatggccggacgtcatgaaatggaagacgcccccgaaggggaaaatggcgccaaaaca
gacgcctga

DBGET integrated database retrieval system