KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1748Help
Entry
Ddes_1748         CDS       T00837                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ddes_1748
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ddes_1748
   00620 Pyruvate metabolism
    Ddes_1748
   00640 Propanoate metabolism
    Ddes_1748
  Energy metabolism
   00680 Methane metabolism
    Ddes_1748
Enzymes [BR:dds01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ddes_1748
Lipid biosynthesis proteins [BR:dds01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ddes_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2114466..2116514
Genome map
AA seq 682 aa AA seqDB search
MSQERITTLLNENRSYLPPEHGKTSAWVCGPEEYNALCRRALEDPNDFWGARASQLIHWF
KRWDKVLEADEANHKYQWFTGGKLNASFNCIDRHLISGRRNKAALIWQGEKETDVRCYTY
QMLYTEVCRVAHAMSSLRIRKGDHVALYMPMIPELFIAMLACARIGAIHTAIFSGYAEGG
VRSRIQGCKARVVITADAAVRGGKFKPLKANLDPILEKCPSVAHVVVVKHAGLENVNMQR
NRDIWWHDLIDDFTLNPDFPCEPMDANDTLFLLHTSGSTGKPTGVMHSTGGYLTYAAHTT
QWCFDMRDDDVYWCTADAGWITGHTYGVYGPLALGATTLMFEGIPTWPYPDRYWRIVENF
RVNILYTAPTVVRSLMRMNEAWTERYDLRSLRILGSVGEPINPEAWHWYHKHIGGSELPI
VDTWWQTETGGAMIAPMPYATKLKPGSASKPLPGIDATVMGSAARDGEEPEAGCKAGHLV
IRRPWPGMMQGVFNDEEKYQSYFSRFGCYSSGDAAEIDQDGYFWILGRIDDSINVSGHRL
STAEIEAVLAACPEVGEAAVVPMPHALKGEGIYVYVVTRDEVPWSADLRAKLREAVRRDI
GALATPEYIQFVEGMPKTTSGKIIRRMLRKIAGDSYEDIGDTTSLAEPDVIPKIISGHRN
LMAGRHEMEDAPEGENGAKTDA
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggaacggatcactacactgttgaatgaaaatcgcagctatcttccaccagag
cacggcaagacgtctgcctgggtttgcggtccggaagagtataatgcactatgccgccgc
gctctggaagaccccaatgacttttggggagcgcgagcatcgcagttgatccattggttc
aaacgctgggacaaagtattggaagctgacgaagcaaaccataaataccagtggtttacc
ggtggaaaactcaatgcttcctttaactgcatcgacagacatctgatttcgggcagacgc
aacaaggccgcccttatctggcaaggcgaaaaagaaacagatgtgcgctgctacacttat
cagatgctttatacagaggtctgccgcgtagcgcatgccatgagttcactgcgcattcgc
aaaggcgaccatgttgccctgtatatgccaatgatacctgagctttttattgccatgctg
gcctgcgcccgcataggcgccatacacacggccatcttttccggctatgcggaagggggc
gtgcgcagccgcatacagggttgcaaggcccgcgtggtcatcacggccgatgcggcagtg
cgcggtggcaagttcaaacccctcaaggccaaccttgaccccatcctggaaaaatgtcct
tcggtggcccacgtggtggtcgtcaagcatgcggggcttgaaaacgtcaacatgcaacgc
aaccgcgatatctggtggcacgaccttattgacgattttacccttaaccccgactttccc
tgcgaaccaatggatgccaatgacacgcttttcctgctgcacaccagcggcagtacgggc
aagcccaccggggtaatgcattccactggcggctacctgacctatgcggcccacaccacc
cagtggtgctttgacatgcgcgatgacgatgtgtactggtgcacggccgatgccggatgg
attaccggccatacctacggtgtgtatggcccgcttgccctgggtgccaccacgctcatg
tttgaaggcatacccacatggccctaccccgacagatactggcgcatcgtggaaaacttc
cgcgtcaatatcctctatacagcgcccacggttgtccgctccctcatgcggatgaacgag
gcgtggacagaacgttacgacctgcgcagcctgcgtatcctgggcagcgtgggcgaaccc
atcaatcccgaagcctggcactggtaccacaagcacatcggcggcagtgaactgcccata
gtggacacgtggtggcagacggaaaccggcggagccatgatcgcccccatgccctacgcc
acaaagctcaaacccggctccgcctcaaagccgctgcccggtattgacgccaccgttatg
gggtcggccgcgcgcgacggcgaagaacccgaagcaggctgcaaggcgggccatcttgtc
attcgccgcccctggccgggcatgatgcagggcgtcttcaatgatgaagagaagtaccag
tcctatttttcgcgcttcggctgctattcttcgggcgacgccgccgaaatcgaccaggac
ggctacttctggatactcggccgtattgacgactccatcaacgtttccggccatcgcctt
tccaccgccgaaatagaagccgtgctggccgcctgccccgaggtgggcgaagcggctgtg
gttcccatgccccacgcccttaaaggcgaaggtatctatgtatacgtggtcacgcgcgat
gaggttccctggagtgcggacctgcgcgccaaactgcgcgaggccgtgcgcagggatatc
ggcgctctggcaacgccggaatacatacaattcgtggagggcatgcccaagaccacatcc
ggcaagatcatacgccgcatgctgcgaaaaatagccggagacagctacgaagatatcggt
gataccacatcgctggccgaacccgatgtcatacccaaaatcatctccgggcaccgcaac
ctcatggccggacgtcatgaaatggaagacgcccccgaaggggaaaatggcgccaaaaca
gacgcctga

DBGET integrated database retrieval system