KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_1933Help
Entry
Ddes_1933         CDS       T00837                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dds01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dds00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2327240..2328481
Genome map
AA seq 413 aa AA seqDB search
MHKDMDALLHGLAGREDRVVTLQSALTACPALGPDNGGDGEQAKAAIIAAWLKACGIKDL
LHVDAPDSRVSSGVRPNLVARIPGRTKRTLWLFGHMDVVPPGDLSAWQSDPWQVRREGDM
LYGRGVEDNQQAITSMLLLAEELQQRHITPELSLGLVFMADEETGSTYGLEHVLTARSGL
FSQDDLYIVPDAGSRQGDVIEVAEKGQLWLKIRTIGVQCHASTPHKGRNAFLAGADMALA
CHHGLNAAFDAADPLFNPPASTFVPGKHDANVPNINTVPGDDVFYVDCRLLPQVDPQAVL
DRTRALADVVAERHGVRIEISVVQQQAASGLAEDSPIITALKTAVAEVYGVEGRVVGIGG
ATVAAQLRQRGLAAAVWSCVENTCHQPNERSSITAAIKDAQVFTHILMNSAHV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcataaggatatggacgcccttttacacggccttgccgggcgcgaggaccgcgtggtg
acgctgcaaagcgcgcttacggcctgcccggctctgggaccggataacggcggtgacggc
gagcaggccaaggccgccattatcgccgcatggctcaaggcctgcggcataaaggacctt
ttgcatgtggacgcccctgacagccgtgtttcctcaggtgtgcggcccaatcttgttgcc
cgcatcccgggcagaacaaaacgtacgctctggcttttcggccacatggacgttgtcccc
cccggcgatctttctgcctggcagtccgacccgtggcaggtacggcgcgagggcgacatg
ctttacggccgcggcgtggaggacaaccagcaggccataacaagcatgctgctgctggcc
gaagaactgcaacagcgccacattacgccggaactgagtcttggccttgtctttatggcc
gatgaagaaacaggcagcacgtacgggctggagcacgtcctcactgccaggtccggactt
ttcagccaagacgacctgtatatcgtacctgacgccggttcgcggcagggcgacgtcatc
gaggtggcagaaaaaggacagctctggctcaagatccgcaccattggcgtgcaatgccat
gcctcaactcctcacaagggccgcaacgcctttctggccggggcggacatggctctcgcc
tgccatcacggcctgaacgcggcttttgatgctgccgacccgcttttcaatcctcccgct
tccacctttgtacccggcaagcacgatgccaatgtgcccaacatcaacaccgtgccgggc
gatgacgttttctatgtggactgccgccttttgccgcaggtggacccgcaggcggtgctg
gacaggacgcgcgcgctggcagacgtggtggcagaacgccacggtgtgcgcatagaaatc
agcgttgtacaacagcaggccgcttcgggcctggctgaagacagcccgatcataacggcc
ctcaagaccgctgtggccgaagtatatggggttgaaggcagggtcgtgggcattggcggg
gctaccgtggcggcgcaactgcggcagcgcggccttgccgccgccgtatggagctgtgtt
gaaaacacctgccatcagcccaacgagcgctcctccatcaccgcagccattaaagatgcc
caggtgttcacccacatactcatgaattccgcccatgtctga

DBGET integrated database retrieval system