KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_2055Help
Entry
Ddes_2055         CDS       T00837                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
dds00250  Alanine, aspartate and glutamate metabolism
dds01100  Metabolic pathways
dds01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ddes_2055
Enzymes [BR:dds01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Ddes_2055
Peptidases [BR:dds01002]
 Cysteine Peptidases
  Family C44
   Ddes_2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase QueC
Motif
Other DBs
NCBI-ProteinID: ACL49951
JGI: Ddes2055
UniProt: B8J3E1
Position
complement(2469892..2471832)
Genome map
AA seq 646 aa AA seqDB search
MCGIAGICRLDASPLDPQARHWVQAMTDRIAHRGPDGEGQWLNGPVCLGHRRLSIIDLGT
GGQPMHSVDGRYAIVFNGEIYNFAELKEELSSAGACFQTSSDTEVILEGYRQWGVDCLAR
FNGMFAFALWDVVEQRLFCARDPFGKKPFFYTVQQGRLHFASELTALEQLRGQGAGLNLT
LRPEAVMRYLAYEYVPTPQTVYGEVESLPPAHWLVLEGGSLRTGRYWDMPVPDENDRRST
DELCEELRVLLARAVRRRMVSDVPLGVFLSGGIDSSIVAGLMARQSSSPVKTFSIGFTEA
SYDESRYARIVAGTFGTDHHERVLSAEECADNLPGIISKMDVPMADASVAPTWLLSGVTR
EKVTVALGGDGADELWAGYEHYIGFKVAEWYNALPAVLRRKVVEPLARRLPSSAGYINPR
LAVATFLRAAQTPAWQRVQTMLTAFTPDMQAEILSGSFRAQAPGFLAPERLFAPTREQYE
HWPHNTAAPLARAFHVYVRQFMLDDILVKVDRCSMLHSLEVRAPFLDRDVAEFAARLPVD
RKLHGFKRKWLLKRAFADLLPREILYRNKRGFQIPVAEWLRGRMRPLVEDLLSADSLRVQ
GIFDPAAVRALVDEHVSGRADLRKPLWTLLVFQLWWQARNGSGTGI
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatagccggtatctgccgattggacgcttcgccccttgatccccaggcccgc
cactgggtgcaggccatgaccgaccgcatcgcccaccggggaccggacggcgaagggcag
tggctgaacggcccggtctgccttgggcacaggcggctctccattattgacctcggcacg
ggcggccagcccatgcacagtgttgatgggcgttatgccatcgtcttcaatggtgaaata
tacaattttgcggaactgaaagaagagctttccagcgccggggcgtgctttcagaccagt
tcggatacagaggtcatccttgagggctaccgccagtggggcgtggactgccttgcccgt
tttaacggcatgtttgcctttgccctgtgggatgttgtggagcagcgccttttttgcgcg
cgtgatcctttcggcaagaagccctttttttatacggtgcagcagggcaggctgcatttc
gcctcggagctgacggcccttgagcaactgcgcggccagggcgccgggctgaacctgacc
ctgcggcccgaagccgtcatgcgctatctggcctatgaatatgtgccgaccccgcagacg
gtgtatggtgaggtggaaagcctgcccccggcgcactggcttgtgcttgaaggcggaagc
ctgcgcaccggccgttactgggacatgcccgtgccggacgaaaacgaccgccgcagcacc
gatgaactttgcgaagagctgcgggttctgctggcccgggccgtgcgccgccgtatggtc
agcgatgtgccgctgggcgtttttctttcgggcggcattgactcgtccattgtggcaggg
ctgatggcccggcagtcgtcctcgccggtaaagaccttttccataggctttaccgaggcc
agctacgacgagtcccgctatgcccgtattgttgccgggaccttcggcacggaccaccac
gagcgcgtactttcggcagaagaatgcgccgacaatctgcccggcatcatcagcaaaatg
gacgtacccatggcggacgcttcggttgcgcccacctggctgctttcgggcgtgacccgc
gaaaaggtcactgtggcgctggggggcgatggcgcggacgaactgtgggccgggtatgag
cactatatcggctttaaggtggcggagtggtataacgctttgcccgccgtgctgcggcgc
aaggttgtggagcctctggcccgccgcctgccgtcgtccgccggatatatcaatccgcgc
cttgcggtagccacgtttttgcgcgccgcgcagactccggcctggcagcgggtgcagacc
atgctgacggcctttacgcccgacatgcaggcggagatattgtccggctccttcagggcg
caggctccgggatttcttgcgccggaacgcctgtttgcgcccacgcgcgaacagtatgag
cactggccccataacacggccgcgccgctggcgagagcctttcatgtgtacgtgcgccag
ttcatgctggatgacattctggtcaaggtagaccgttgctccatgctgcacagccttgag
gtgcgcgcaccgtttctggacagggatgtggccgaattcgccgcccgtctgcctgtggac
cgcaaactgcacggcttcaagcgcaagtggctgctcaagcgggcgtttgccgacctgttg
cccagagagatactgtatcgcaacaagcggggttttcagattcccgttgctgaatggctg
cgcggacgcatgcggccgcttgtggaagacctgctcagcgcagacagcctcagggtgcag
ggtatttttgaccctgccgccgtgcgcgcccttgtggacgaacatgtttcgggcagggcg
gacctgcgcaagccgctctggaccctgctggtcttccagctctggtggcaggcgcgcaac
ggaagcggaacaggtatatag

DBGET integrated database retrieval system