KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_2099Help
Entry
Ddes_2099         CDS       T00837                                 

Definition
(GenBank) CoB--CoM heterodisulfide reductase
  KO
K03389  heterodisulfide reductase subunit B2 [EC:1.8.7.3 1.8.98.4 1.8.98.5 1.8.98.6]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
dds00680  Methane metabolism
dds01100  Metabolic pathways
dds01120  Microbial metabolism in diverse environments
dds01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Ddes_2099
Enzymes [BR:dds01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.7  With an iron-sulfur protein as acceptor
    1.8.7.3  ferredoxin:CoB-CoM heterodisulfide reductase
     Ddes_2099
   1.8.98  With other, known, physiological acceptors
    1.8.98.4  coenzyme F420:CoB-CoM heterodisulfide,ferredoxin reductase
     Ddes_2099
    1.8.98.5  H2:CoB-CoM heterodisulfide,ferredoxin reductase
     Ddes_2099
    1.8.98.6  formate:CoB-CoM heterodisulfide,ferredoxin reductase
     Ddes_2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCG DUF997
Motif
Other DBs
NCBI-ProteinID: ACL49995
JGI: Ddes2099
UniProt: B8J3I5
Position
2528263..2529183
Genome map
AA seq 306 aa AA seqDB search
MNFAYYPGCSARGSSKDYEMSTQAVCKALDMNLVDIPDWNCCGSTPAHAVDTELSAALCV
RNLDIAAQQQAELLLTPCPSCLSNLKLAARRMEDPAFRQRVDELLDGPSAKTFPPVTSVM
QGIAEAYDMETIAARVRKSLKGLRLAAYYGCLMSRPAEIMNFGDPENPTLMESMLAACGA
EMVDFPLKTACCGASFGIPERVMTARNSGRILDLATQLGVDAVIVACPLCQMNLDLRQQQ
ASKEMGTAFHLPVLYFTQMMGIAFGLDHKELGLNKLRVSPDGLIRKLDELRRNSAAADKA
AEGGRS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgcctactaccccggctgctcggcccgaggctcttccaaggactacgaaatg
tccacccaggccgtgtgcaaggcgctggacatgaaccttgtggatattccggactggaac
tgctgtggctccaccccggcccacgccgtggataccgagctttccgcggccctgtgcgtg
cgcaacctcgacattgccgcccagcagcaggccgaactgctgctcacgccctgcccgagc
tgcctttccaatctcaagctggccgccagacgtatggaagaccccgcgtttcgccaacgt
gtggacgaactgctcgacggcccctcggccaagacctttccgcccgtgacctcggtcatg
cagggcattgccgaagcctatgatatggaaaccatcgccgcccgggtgcgcaaaagcctc
aagggtctcaggctggccgcctattacggctgcctcatgagccgccccgcagagatcatg
aacttcggcgatccggaaaatcccacacttatggaaagcatgctcgctgcctgcggcgct
gaaatggtggactttcccctcaaaacagcctgctgtggcgcgtcgttcggcattcccgaa
cgcgtgatgacggcccgcaattccgggcgcatcctcgaccttgccacgcagcttggcgtg
gatgccgtcatcgtggcctgcccgctctgccagatgaaccttgatctgcgccagcagcag
gcatccaaagaaatgggcacggccttccacctgccggtgctctacttcacccagatgatg
ggcatagcctttggccttgaccacaaggaactggggcttaacaaactgcgcgtcagccct
gacggcctcatccgcaagctggacgaactccggcgcaattccgccgccgcagacaaggcc
gctgaaggaggcaggtcatga

DBGET integrated database retrieval system