KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_2099Help
Entry
Ddes_2099         CDS       T00837                                 

Definition
CoB--CoM heterodisulfide reductase (EC:1.8.98.1)
Orthology
K03389  
heterodisulfide reductase subunit B [EC:1.8.98.1]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ddes_2099
  Energy metabolism
   00680 Methane metabolism
    Ddes_2099
Enzymes [BR:dds01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.98  With other, known, acceptors
    1.8.98.1  CoB---CoM heterodisulfide reductase
     Ddes_2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2528263..2529183
Genome map
AA seq 306 aa AA seqDB search
MNFAYYPGCSARGSSKDYEMSTQAVCKALDMNLVDIPDWNCCGSTPAHAVDTELSAALCV
RNLDIAAQQQAELLLTPCPSCLSNLKLAARRMEDPAFRQRVDELLDGPSAKTFPPVTSVM
QGIAEAYDMETIAARVRKSLKGLRLAAYYGCLMSRPAEIMNFGDPENPTLMESMLAACGA
EMVDFPLKTACCGASFGIPERVMTARNSGRILDLATQLGVDAVIVACPLCQMNLDLRQQQ
ASKEMGTAFHLPVLYFTQMMGIAFGLDHKELGLNKLRVSPDGLIRKLDELRRNSAAADKA
AEGGRS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgcctactaccccggctgctcggcccgaggctcttccaaggactacgaaatg
tccacccaggccgtgtgcaaggcgctggacatgaaccttgtggatattccggactggaac
tgctgtggctccaccccggcccacgccgtggataccgagctttccgcggccctgtgcgtg
cgcaacctcgacattgccgcccagcagcaggccgaactgctgctcacgccctgcccgagc
tgcctttccaatctcaagctggccgccagacgtatggaagaccccgcgtttcgccaacgt
gtggacgaactgctcgacggcccctcggccaagacctttccgcccgtgacctcggtcatg
cagggcattgccgaagcctatgatatggaaaccatcgccgcccgggtgcgcaaaagcctc
aagggtctcaggctggccgcctattacggctgcctcatgagccgccccgcagagatcatg
aacttcggcgatccggaaaatcccacacttatggaaagcatgctcgctgcctgcggcgct
gaaatggtggactttcccctcaaaacagcctgctgtggcgcgtcgttcggcattcccgaa
cgcgtgatgacggcccgcaattccgggcgcatcctcgaccttgccacgcagcttggcgtg
gatgccgtcatcgtggcctgcccgctctgccagatgaaccttgatctgcgccagcagcag
gcatccaaagaaatgggcacggccttccacctgccggtgctctacttcacccagatgatg
ggcatagcctttggccttgaccacaaggaactggggcttaacaaactgcgcgtcagccct
gacggcctcatccgcaagctggacgaactccggcgcaattccgccgccgcagacaaggcc
gctgaaggaggcaggtcatga

DBGET integrated database retrieval system