KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_2147Help
Entry
Ddes_2147         CDS       T00837                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dds03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2587904..2588512
Genome map
AA seq 202 aa AA seqDB search
MNKRIPEPLKALVEQLARLPGLGPKSAMRAAMALLKWPEAETRRLGRGIHDLRDNLHLCS
RCGGLASTDPCPVCADAERARDTLCLVTEWDSMLTLDEGGFYRGQYMILGGLLAPLERMD
AEGLDTDRLVRRLDEGEVTELILALGATLEAENTATFIRRLVAGRFPHVRISRLAQGIPL
GAEVKYMDKETLRQSLQYRQDL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgtattcccgaaccactcaaggccctggtggagcagctcgcgcgcctgccg
ggccttggccccaaatccgccatgcgcgcggccatggccctgctcaaatggccggaggcc
gaaacccgccgcctggggcgcggcatccatgacctgcgcgacaacctgcacctgtgctcg
cgctgcggcggacttgcgtccacagacccctgcccggtctgtgccgatgccgaacgcgcg
cgcgacacgctctgcctggtcaccgagtgggacagcatgcttaccctggacgaaggcggc
ttttaccgggggcagtacatgatcctcggcggtctgctggcccccctggaacggatggac
gctgaaggtctcgatacagaccggctggtgcgccggctggatgagggagaggtgaccgag
cttatcctggctctcggggctacgctggaagcggaaaatactgctacgttcatccgccgt
ctggtggccgggcgttttccgcatgtgcgcatttcgcggctggcgcaaggcattcccctg
ggcgcagaagtcaaatatatggacaaagaaaccctgcgacagtcgcttcagtaccggcag
gacctctaa

DBGET integrated database retrieval system