KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_2147Help
Entry
Ddes_2147         CDS       T00837                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dds00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ddes_2147
DNA repair and recombination proteins [BR:dds03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Ddes_2147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2587904..2588512
Genome map
AA seq 202 aa AA seqDB search
MNKRIPEPLKALVEQLARLPGLGPKSAMRAAMALLKWPEAETRRLGRGIHDLRDNLHLCS
RCGGLASTDPCPVCADAERARDTLCLVTEWDSMLTLDEGGFYRGQYMILGGLLAPLERMD
AEGLDTDRLVRRLDEGEVTELILALGATLEAENTATFIRRLVAGRFPHVRISRLAQGIPL
GAEVKYMDKETLRQSLQYRQDL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgtattcccgaaccactcaaggccctggtggagcagctcgcgcgcctgccg
ggccttggccccaaatccgccatgcgcgcggccatggccctgctcaaatggccggaggcc
gaaacccgccgcctggggcgcggcatccatgacctgcgcgacaacctgcacctgtgctcg
cgctgcggcggacttgcgtccacagacccctgcccggtctgtgccgatgccgaacgcgcg
cgcgacacgctctgcctggtcaccgagtgggacagcatgcttaccctggacgaaggcggc
ttttaccgggggcagtacatgatcctcggcggtctgctggcccccctggaacggatggac
gctgaaggtctcgatacagaccggctggtgcgccggctggatgagggagaggtgaccgag
cttatcctggctctcggggctacgctggaagcggaaaatactgctacgttcatccgccgt
ctggtggccgggcgttttccgcatgtgcgcatttcgcggctggcgcaaggcattcccctg
ggcgcagaagtcaaatatatggacaaagaaaccctgcgacagtcgcttcagtaccggcag
gacctctaa

DBGET integrated database retrieval system