KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_0032Help
Entry
DehaBAV1_0032     CDS       T00518                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
deb00230  Purine metabolism
deb01100  Metabolic pathways
Module
deb_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DehaBAV1_0032
Enzymes [BR:deb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     DehaBAV1_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 HflK_N AAA_22
Motif
Other DBs
NCBI-ProteinID: ABQ16624
JGI: DehaBAV10032
Position
complement(30928..31545)
Genome map
AA seq 205 aa AA seqDB search
MTNWNFNKAEKPLLLIVSGPSGVGKDAVLARMKERKLPLTYIVTTTTRPKRETETEGVDY
NFIRPAEFQELISQNELLEWANVYGNFYGVPKAPIRQALSRGSDVIVKVDVQGAASIKKI
VPNAVFIFLMPPDMDELTRRLEHRLTESPESLRRRLATAPLEIEKLPDFDYVVVNPEGEI
DNAVREIMSIIAAEHCRIQPRLIEL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacaaactggaactttaataaagctgaaaaacccctgctattgattgtttccggtcct
tccggcgtaggtaaagatgcagttctggcccgtatgaaagagcgcaaactgcccctgacc
tatatagtcacaaccaccacccgccccaaacgggaaaccgaaaccgagggagttgattat
aattttatcagaccggctgaatttcaagagcttatcagccagaatgaactgctggaatgg
gctaacgtttacggaaatttttacggcgtccccaaagcgcctatcaggcaagccttatcc
cgcggttcagacgttattgtaaaagtggacgttcagggtgcggccagcatcaaaaaaata
gtgccgaatgcggtatttattttcctgatgcccccggatatggacgaactgacccgccgt
ctggaacaccgcctgaccgaatcacccgaatccctcagacggcgactggctactgccccg
ctcgaaatagaaaaactccccgactttgactacgtggtagtcaacccagagggggagatt
gataatgctgtccgtgagattatgtctattattgcggccgaacactgccgcatacagccc
cgtttaattgaactttag

DBGET integrated database retrieval system