KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_0046Help
Entry
DehaBAV1_0046     CDS       T00518                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
deb00010  Glycolysis / Gluconeogenesis
deb00052  Galactose metabolism
deb00500  Starch and sucrose metabolism
deb00520  Amino sugar and nucleotide sugar metabolism
deb00521  Streptomycin biosynthesis
deb01100  Metabolic pathways
deb01110  Biosynthesis of secondary metabolites
deb01120  Microbial metabolism in diverse environments
deb01130  Biosynthesis of antibiotics
deb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehaBAV1_0046
   00052 Galactose metabolism
    DehaBAV1_0046
   00500 Starch and sucrose metabolism
    DehaBAV1_0046
   00520 Amino sugar and nucleotide sugar metabolism
    DehaBAV1_0046
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DehaBAV1_0046
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    DehaBAV1_0046
Enzymes [BR:deb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DehaBAV1_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase SIS_2 FGGY_N
Motif
Other DBs
NCBI-ProteinID: ABQ16638
JGI: DehaBAV10046
Position
40262..41269
Genome map
AA seq 335 aa AA seqDB search
MNRSNSEVMSKPCLCLDIGGSKIRSAVVTHDGRVVAWEQEPTCALNGVTGVFESICLVLD
RLLERNNLNTSQFEALAAAVAGGIDMPNGLVTQSPHLPDWRDVPLRDMLTERYLKTFIIN
DASAAALGEHRLGVGLGVKNLVYLTVSTGIGGGIIINNELYLGQSGCAGEIGHMCLDING
KEDVCGNKGCLETLASGTAIVSRVQTELAGGEFSVLVERFKADYSALTAEDIGRAASEGD
RLCLGIIRQAGEYLGIGLVNIANIFNPELIILGGGVSKLGEIFIEPARQVLYKRAFRLAG
DDVRLIVSVLGDNAGVIGAALYAYACLDSANNQPQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccgtagtaattcagaggttatgagcaagccctgtttgtgtctggatataggcggc
agtaaaatccgttcggcggtggtcacccatgacggacgggtggtggcttgggaacaggag
cctacctgtgccctcaacggggtaacgggtgtatttgagagcatctgcctggtgcttgac
cgcttgcttgagcgtaacaacctgaatacctcacagtttgaggcacttgctgcggcagtt
gccgggggtatagatatgccaaacgggctggttacccagtctccccatttgcccgactgg
cgggacgtgcccctcagggatatgcttacagaacgttatctcaagacctttattataaat
gatgcttcggctgcggcactgggtgaacaccgtctgggagtggggctgggagttaaaaat
ctggtttacctgaccgtttccaccggtatcgggggcggtattattataaataacgagctg
tatctggggcagagcggctgtgccggtgaaatagggcatatgtgtctggatataaacggc
aaggaagatgtctgcggcaacaaaggctgtttggaaacactggcttcgggtacggctatt
gtcagcagggttcagaccgaacttgctgggggtgaattttccgtactggtagaacgcttc
aaggcggattattcggctttgaccgcagaggatataggcagggcggcttcagagggtgac
aggctgtgtctggggattatccgtcaggcaggggaatatctgggaatcgggctggtgaat
attgccaatatatttaacccggagcttattatactggggggcggggtttccaagctggga
gagatatttattgagcctgcccgccaagtgctttataaacgggctttccgtctggcgggg
gatgatgtccgcctgatagtttcggttctgggggataatgccggggtgattggggcagct
ctgtatgcctatgcctgtctggatagtgcgaacaaccagcctcagtga

DBGET integrated database retrieval system