KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_0353Help
Entry
DehaBAV1_0353     CDS       T00518                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
deb00900  Terpenoid backbone biosynthesis
deb01100  Metabolic pathways
deb01110  Biosynthesis of secondary metabolites
deb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DehaBAV1_0353
Enzymes [BR:deb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     DehaBAV1_0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ABQ16938
JGI: DehaBAV10353
Position
complement(361494..362627)
Genome map
AA seq 377 aa AA seqDB search
MVHSIKKVVILGSTGSIGRQTLEVIRSLPDHFKVLGLAGGANVNLLKEQAGEFRPEYIYC
RDCHKESACNSRFIPMEEMAALPEADVIVVATPGGAGLQPVLAAAKASKVIALANKESLV
SAGEIVTGIVRENKAKLLPVDSEHSAIWQCLSGEVTPPSRIILTASGGPFRSLTKNEIDK
VTPEQALKHPSWKMGLKVTIDSASLMNKGLEIIEARWLFDMHIQNIQVVIHPQSIIHSMV
EFADGSLKAQLSRPDMRFPIQYALTYPERVANHTLPRLNWAEVGKLDFEIPDMTRFPCLG
LAISAGEEGKTFPAALCAADEVAVDLFLKGKISFGQIPELIAKVLDAHQPVSKPDIDDIL
AADAWARQKVTELAGNL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggttcattcaataaagaaagttgtcatactggggtctaccggttctatcggccgacag
actcttgaagttatccgttcactgccagaccacttcaaggtactggggctggctggcgga
gcaaatgtaaatctgctaaaagaacaggctggtgaattccgtcctgaatatatatactgc
cgtgactgccataaggaaagtgcctgcaattcccgcttcattcctatggaggaaatggcc
gccctgcccgaagcagacgtaatagtagtggccactcccggcggtgccggtttacagccg
gtacttgcggctgctaaagccagtaaggtaatagctctggccaacaaggagtctctggtt
tccgccggtgaaatagtaaccggtattgtacgggaaaataaagctaaactactaccagta
gacagtgaacacagtgccatctggcaatgtttgtcaggtgaggttacacccccttccaga
attatactgaccgcctccggcggacctttccgttctttgactaaaaacgaaatagataaa
gtcacccccgaacaagcactgaagcacccctcatggaaaatggggcttaaagttaccata
gactcggccagtttgatgaacaaaggtctggaaataatagaagcccgctggctgtttgat
atgcacatacagaatattcaggtggttatccacccccagagcattatccactccatggtg
gagtttgcagacggcagtttaaaggcccagctttcgcgcccggatatgcgtttcccgatt
cagtatgccctgacttaccccgaaagagtggccaaccataccctgccccgccttaactgg
gcggaagtgggcaaactggattttgaaataccggacatgaccagattcccctgtctgggt
ctggcgatatcagccggagaagaaggaaaaacatttccggcagcattatgtgccgcagac
gaagtggctgtagatctgttccttaagggtaaaataagcttcgggcagatacccgaactg
atagccaaagtattggatgcccatcagccggtttccaagccggatattgatgatattttg
gccgcagatgcttgggcgcgccaaaaagtaaccgaactggcaggtaatttataa

DBGET integrated database retrieval system