KEGG   Dehalococcoides sp. BAV1: DehaBAV1_0557Help
Entry
DehaBAV1_0557     CDS       T00518                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
deb  Dehalococcoides sp. BAV1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:deb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(543102..543716)
Genome map
AA seq 204 aa AA seqDB search
MKDTSLPSTAGVVNKLIDSLGKLPGIGPKSAQRLAFYLMRAPEDQVISLSDTIRNIKNQI
SQCRICCNVADSELCPICQNTKRETNKICVVEQPQDILALEHVGVYRGYYHVLHGAISPT
EGITSQNIRINELMVRLDNGQVEEIILATNPTTEGEATAMYLSRLITPLGIKVTRLARGL
PFGTELEYADDVTLSRAMEGRQNF
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggacacttctttaccgtctacggccggtgtggtaaacaagctgatagattcactg
ggcaaactgccgggtataggcccgaaaagcgcccagcgtctggcattttaccttatgcgg
gcacctgaagatcaggttatttccctctcagacactatccgcaatataaaaaaccagata
agccagtgccgcatttgctgtaacgtggctgatagtgagctttgccccatttgccagaat
accaaacgcgaaacaaataagatttgcgtggttgaacagcctcaggatattctggctctt
gaacatgtaggtgtctaccgcggatactaccatgtactgcatggagctatttcccccacc
gaagggataacctcccagaacatacgtataaacgagcttatggttcggctggataatggt
caggtagaagagattattctggctaccaatcccactaccgaaggtgaagccaccgccatg
tacctttcgcggctgataaccccactgggtataaaagtgaccagactggcacggggctta
cccttcgggacagaactggaatatgctgacgatgtaactttaagccgagccatggaggga
cgccagaacttttag

DBGET integrated database retrieval system