KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_0656Help
Entry
DehaBAV1_0656     CDS       T00518                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit (EC:1.2.7.1)
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DehaBAV1_0656
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehaBAV1_0656
   00020 Citrate cycle (TCA cycle)
    DehaBAV1_0656
   00620 Pyruvate metabolism
    DehaBAV1_0656
   00640 Propanoate metabolism
    DehaBAV1_0656
   00650 Butanoate metabolism
    DehaBAV1_0656
  Energy metabolism
   00680 Methane metabolism
    DehaBAV1_0656
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DehaBAV1_0656
Enzymes [BR:deb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DehaBAV1_0656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
646380..646952
Genome map
AA seq 190 aa AA seqDB search
MKHFIEIRWHGRGGQGAVTSAELIAQAAIGKGKYAQAFPSFGPERRGAPVQSFNRISDNN
PIRERSGINQPDIVVVLDPSLVIIGNVISGLKDGGTLIINTTKPLEHFASQYGDRWKVAT
VDATAIAKEVLGVNIVNTTMLGALIKATGLADMEAFEEPLKHRFGKLAAKNMAAMKKAFE
ETVVKELKVG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattttattgaaatcagatggcatgggcgtggcggtcagggtgcggtaacctca
gctgagcttatcgcccaggcagcaatcggtaagggaaagtatgctcaggcattccccagt
ttcgggcctgaacgcagaggtgccccggttcaatctttcaatcgtatcagtgacaacaat
cccatccgtgaacgttcaggtatcaaccagccggatattgtggtggtgcttgaccccagt
ttggttatcatcgggaatgtaatctcaggtcttaaagatggcggcactcttattatcaac
accacaaagcctctggaacattttgcttctcaatacggtgatcgctggaaagtagccaca
gttgatgcaactgctattgccaaagaagtcttaggtgtcaatattgttaatacaaccatg
cttggcgcccttataaaggctaccggtctggcggatatggaagccttcgaagaaccttta
aaacaccgctttggaaagctggctgccaaaaatatggctgctatgaaaaaggcctttgaa
gagactgttgtaaaggagcttaaagttggctaa

DBGET integrated database retrieval system