KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_0672Help
Entry
DehaBAV1_0672     CDS       T00518                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DehaBAV1_0672 (tpiA)
   01230 Biosynthesis of amino acids
    DehaBAV1_0672 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehaBAV1_0672 (tpiA)
   00051 Fructose and mannose metabolism
    DehaBAV1_0672 (tpiA)
   00562 Inositol phosphate metabolism
    DehaBAV1_0672 (tpiA)
Enzymes [BR:deb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DehaBAV1_0672 (tpiA)
Exosome [BR:deb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DehaBAV1_0672 (tpiA)
  Exosomal proteins of bladder cancer cells
   DehaBAV1_0672 (tpiA)
  Exosomal proteins of melanoma cells
   DehaBAV1_0672 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(661818..662579)
Genome map
AA seq 253 aa AA seqDB search
MRQIIIAGNWKMNTTLSEACTLVQSMKCELERIEGIEKIICPPFISLYPIKTMLENSSIK
LGAQNLFYQEKGAYTGEISPLMLKELCQYVIIGHSERRAYFGETGQVVNQKIKAALQAGL
LPIVCVGEKPEENENGQTRQVLETQLKEALDGLNLSCIIIAYEPIWAIGTGKAATASEAN
SAIGYIRRVLGDTLGNAAAQTSPILYGGSVNEKNITEILSQTNIDGALVGGASLKAESFV
SICRQAAVIQNKH
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaaattattattgctggaaactggaaaatgaataccactctttccgaagcttgt
acacttgttcagagcatgaaatgcgaacttgagcggatagaaggcattgagaaaataatc
tgcccaccctttatatcgctgtatcccataaaaaccatgctggaaaatagcagcatcaaa
ctaggtgctcaaaaccttttctatcaggaaaaaggggcttatacaggtgagatatcccct
ctgatgctgaaagaactctgccaatacgttattataggccactctgaaagacgggcatat
ttcggtgaaacaggacaggtggtcaaccaaaagataaaggccgctcttcaggcaggccta
ctcccgatagtatgcgtgggcgaaaagcctgaagagaatgaaaacggccaaacccgccaa
gtgctggaaacccagctaaaagaggctctggacgggcttaacctcagctgtatcataata
gcctacgaacccatctgggcaatcggcaccggcaaggccgctaccgcttcagaagccaac
tctgccattggttatatccgccgggtgcttggtgatactctgggcaatgccgcagcccaa
acttctcctatactatatggcggcagtgtaaatgaaaaaaatattaccgaaattctttct
cagacgaatattgacggggctttggtgggtggcgcttccctaaaggctgaatcttttgta
agcatttgccgccaagccgccgttattcaaaataagcactaa

DBGET integrated database retrieval system