KEGG   Dehalococcoides sp. BAV1: DehaBAV1_0672Help
Entry
DehaBAV1_0672     CDS       T00518                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
deb  Dehalococcoides sp. BAV1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:deb01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:deb01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:deb00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:deb00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:deb00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(661818..662579)
Genome map
AA seq 253 aa AA seqDB search
MRQIIIAGNWKMNTTLSEACTLVQSMKCELERIEGIEKIICPPFISLYPIKTMLENSSIK
LGAQNLFYQEKGAYTGEISPLMLKELCQYVIIGHSERRAYFGETGQVVNQKIKAALQAGL
LPIVCVGEKPEENENGQTRQVLETQLKEALDGLNLSCIIIAYEPIWAIGTGKAATASEAN
SAIGYIRRVLGDTLGNAAAQTSPILYGGSVNEKNITEILSQTNIDGALVGGASLKAESFV
SICRQAAVIQNKH
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaaattattattgctggaaactggaaaatgaataccactctttccgaagcttgt
acacttgttcagagcatgaaatgcgaacttgagcggatagaaggcattgagaaaataatc
tgcccaccctttatatcgctgtatcccataaaaaccatgctggaaaatagcagcatcaaa
ctaggtgctcaaaaccttttctatcaggaaaaaggggcttatacaggtgagatatcccct
ctgatgctgaaagaactctgccaatacgttattataggccactctgaaagacgggcatat
ttcggtgaaacaggacaggtggtcaaccaaaagataaaggccgctcttcaggcaggccta
ctcccgatagtatgcgtgggcgaaaagcctgaagagaatgaaaacggccaaacccgccaa
gtgctggaaacccagctaaaagaggctctggacgggcttaacctcagctgtatcataata
gcctacgaacccatctgggcaatcggcaccggcaaggccgctaccgcttcagaagccaac
tctgccattggttatatccgccgggtgcttggtgatactctgggcaatgccgcagcccaa
acttctcctatactatatggcggcagtgtaaatgaaaaaaatattaccgaaattctttct
cagacgaatattgacggggctttggtgggtggcgcttccctaaaggctgaatcttttgta
agcatttgccgccaagccgccgttattcaaaataagcactaa

DBGET integrated database retrieval system