KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_0672Help
Entry
DehaBAV1_0672     CDS       T00518                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
deb00010  Glycolysis / Gluconeogenesis
deb00051  Fructose and mannose metabolism
deb00562  Inositol phosphate metabolism
deb01100  Metabolic pathways
deb01110  Biosynthesis of secondary metabolites
deb01120  Microbial metabolism in diverse environments
deb01130  Biosynthesis of antibiotics
deb01200  Carbon metabolism
deb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehaBAV1_0672
   00051 Fructose and mannose metabolism
    DehaBAV1_0672
   00562 Inositol phosphate metabolism
    DehaBAV1_0672
Enzymes [BR:deb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DehaBAV1_0672
Exosome [BR:deb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DehaBAV1_0672
  Exosomal proteins of bladder cancer cells
   DehaBAV1_0672
  Exosomal proteins of melanoma cells
   DehaBAV1_0672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABQ17256
JGI: DehaBAV10672
UniProt: A5FRB6
Position
complement(661818..662579)
Genome map
AA seq 253 aa AA seqDB search
MRQIIIAGNWKMNTTLSEACTLVQSMKCELERIEGIEKIICPPFISLYPIKTMLENSSIK
LGAQNLFYQEKGAYTGEISPLMLKELCQYVIIGHSERRAYFGETGQVVNQKIKAALQAGL
LPIVCVGEKPEENENGQTRQVLETQLKEALDGLNLSCIIIAYEPIWAIGTGKAATASEAN
SAIGYIRRVLGDTLGNAAAQTSPILYGGSVNEKNITEILSQTNIDGALVGGASLKAESFV
SICRQAAVIQNKH
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaaattattattgctggaaactggaaaatgaataccactctttccgaagcttgt
acacttgttcagagcatgaaatgcgaacttgagcggatagaaggcattgagaaaataatc
tgcccaccctttatatcgctgtatcccataaaaaccatgctggaaaatagcagcatcaaa
ctaggtgctcaaaaccttttctatcaggaaaaaggggcttatacaggtgagatatcccct
ctgatgctgaaagaactctgccaatacgttattataggccactctgaaagacgggcatat
ttcggtgaaacaggacaggtggtcaaccaaaagataaaggccgctcttcaggcaggccta
ctcccgatagtatgcgtgggcgaaaagcctgaagagaatgaaaacggccaaacccgccaa
gtgctggaaacccagctaaaagaggctctggacgggcttaacctcagctgtatcataata
gcctacgaacccatctgggcaatcggcaccggcaaggccgctaccgcttcagaagccaac
tctgccattggttatatccgccgggtgcttggtgatactctgggcaatgccgcagcccaa
acttctcctatactatatggcggcagtgtaaatgaaaaaaatattaccgaaattctttct
cagacgaatattgacggggctttggtgggtggcgcttccctaaaggctgaatcttttgta
agcatttgccgccaagccgccgttattcaaaataagcactaa

DBGET integrated database retrieval system