KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_1019Help
Entry
DehaBAV1_1019     CDS       T00518                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
deb00010  Glycolysis / Gluconeogenesis
deb00620  Pyruvate metabolism
deb00640  Propanoate metabolism
deb00680  Methane metabolism
deb01100  Metabolic pathways
deb01110  Biosynthesis of secondary metabolites
deb01120  Microbial metabolism in diverse environments
deb01130  Biosynthesis of antibiotics
deb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehaBAV1_1019
   00620 Pyruvate metabolism
    DehaBAV1_1019
   00640 Propanoate metabolism
    DehaBAV1_1019
  Energy metabolism
   00680 Methane metabolism
    DehaBAV1_1019
Enzymes [BR:deb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DehaBAV1_1019
Lipid biosynthesis proteins [BR:deb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DehaBAV1_1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABQ17599
JGI: DehaBAV11019
Position
1010833..1012791
Genome map
AA seq 652 aa AA seqDB search
MSTEEKKFDTQNLPTKTYFWPLKRYQDLYNSSLSDPEAFWAKHSDVLSWEKPWERVLDWN
PPYARWFVGGKLNMSYQCVDRHAKSWRKSKVAIYWEGENGDTQTISYSNLYENVNRYASV
LKKLGIGKGDKVTVYLPMIPEMVYILLACNRVGAVHNVIFSGFSSQSIADRVNDSGSKMI
VTASGGHRRGKILPLKEIVDEAVKSTPTIEHVLVIKYTGHEVVMDPTKDVWAHDLLKDAD
KYVAPEAMESTDPLFILYTSGTTGKPKGILHGTGGYGVWACNTLKWAFKPTDESVFWCTA
DVGWITGHTYVVYAPLALGLTQVIYEGAPDYPSVDRWWEIIDKYGVSIFYTSPTAIRMFM
RHGEELPAKHDLSTLEMLGSVGEPINPEAWEWYYKNIGHENCPISDTWWQTETGGFMITP
CPGIQSFPLKPGSATLPLPGVDPVVVDAEGKILPANETGFIAIRKPWPGIMLGIYNGDEL
YKKTYWSRFPGWYCPGDFSMKDSDGYLWLLGRADEVIKVAGHRISTAELEHALVGHSSVA
EAAVASRPDEVKGEAIVVFVTLKKNVEASAEVKRELTHHLRSAIGTIATPEEIIFVEKLP
KTRSGKIMRRLLKAVANEVPIGDTTTLDDETSVNEARAAFDELLAARKHHKH
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgaagaaaagaagtttgacacgcaaaatctgcctaccaagacctatttctgg
ccacttaaaagataccaggatctatacaacagctcgctatctgaccctgaggctttctgg
gcaaaacactcagatgtgctttcatgggaaaagccatgggaaagagtactggactggaat
ccgccttatgcccgctggtttgtaggcggcaagctgaatatgtcttaccaatgcgtagac
cgccatgccaaaagctggcgtaaaagcaaggtagctatctactgggagggtgaaaacggg
gatacccaaactatcagctattcgaacctttacgaaaacgtaaaccgctatgcctctgta
ctgaaaaagctgggcataggcaagggagacaaagtaaccgtctacctgcccatgatacct
gaaatggtctatatcctgctggcctgcaaccgggttggggccgtccacaacgtaatattt
tcaggtttttcttcccagtctattgcagacagggtgaatgactccggttcaaaaatgatt
gtaaccgccagcggcggccaccgccgcggtaaaatactgccgctcaaggaaatagtagat
gaggcagtcaaatccacccctactattgaacatgtactggttattaaatataccggccat
gaagtggttatggaccccaccaaagatgtgtgggcacatgatttgcttaaagatgccgat
aaatatgtagctcctgaagccatggaatctaccgacccgctctttatcctgtacacttca
ggtactaccggcaaaccaaagggcattctgcatggtacgggcggttacggtgtctgggca
tgtaataccttaaaatgggctttcaaacccactgatgaatcagtcttctggtgcacagca
gacgtaggctggattaccgggcacacttacgtagtatatgccccgctggctctgggtctg
actcaggttatctacgaaggtgcaccggactatccttcggttgaccgctggtgggagatt
attgataaatacggggtaagcatattctatacctcacctaccgccatacgcatgtttatg
cgccacggcgaggaactgcctgccaaacatgaccttagcacccttgagatgctgggaagc
gtaggcgaacccatcaaccctgaggcatgggaatggtactacaaaaatataggccatgag
aactgccctatttctgatacctggtggcagaccgaaacaggcggttttatgattaccccc
tgtccgggtatccagtccttcccgttaaaaccgggctcggccactttgcctctgccgggt
gttgatcctgtagtggtagatgctgaaggtaaaatcctgccggctaatgagaccggtttt
attgctatccgcaaaccatggccgggcataatgctgggcatatataacggagatgaactt
tacaaaaagacctactggagccgtttccccggctggtattgtccgggtgacttctccatg
aaagattcagacggctatctctggcttttgggacgggctgacgaagttatcaaagtagcc
ggacaccgcataagcaccgccgaactggagcatgcactggtaggccacagttcagttgcc
gaagcggcagtagcttcacgccctgacgaagtaaagggcgaggccattgtggttttcgtc
accctgaagaaaaacgtggaagcctctgcagaggtaaaaagagaactcacccaccatctc
cgctcggctatcggcactattgccactccggaggagattatcttcgtagagaaactgccc
aaaacccgttcgggcaagattatgcgccgcctgctgaaggctgttgccaacgaagtacct
atcggtgataccactacccttgacgatgaaacttcggtcaatgaagccagagcggctttc
gacgaactgctggcggcacgcaaacaccacaaacactag

DBGET integrated database retrieval system