KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_1034Help
Entry
DehaBAV1_1034     CDS       T00518                                 

Definition
D-fructose 1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DehaBAV1_1034
   01230 Biosynthesis of amino acids
    DehaBAV1_1034
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehaBAV1_1034
   00030 Pentose phosphate pathway
    DehaBAV1_1034
   00051 Fructose and mannose metabolism
    DehaBAV1_1034
  Energy metabolism
   00680 Methane metabolism
    DehaBAV1_1034
Enzymes [BR:deb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     DehaBAV1_1034
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     DehaBAV1_1034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1027406..1028503
Genome map
AA seq 365 aa AA seqDB search
MKVTLSVIKADIGGFVGHSDSHPQCLARAEKHLAEAKKKGMLIDYHITKCGDDLQLIMTH
QKGINNKVIHEMAWDTFVSCTEVAKELKLYGAGQDLLCDAFSGNVKGMGPGVAEMEIDER
PSEPIIIFMADKTSSGAWNLPLYKMFADPFNTIGLVIAENMHDGFSFEVHDVKESKGITF
NTPEEIYDLLVFIGAPSRFAIKSVSTRKGEIAAVSSTQKLALLAGRYVGKDDPVCIVRAQ
GAFPAVGEILEPFTQPYLVEGWMRGSHNGPIMPVSVEDSTPTRFDGPPRVTALGFQLSNG
MLIGPRDMFKDKSFDNARQKSLDMADMMRSHGPFEPHRLPLEEMEYTTMPQVSKKLAGRF
KPLKD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaccctgagtgttattaaagcagatatcggcggttttgtgggccattcggac
tcacacccgcagtgtctggccagagctgaaaagcatctggcagaagccaaaaagaagggc
atgctgattgattaccacataaccaagtgcggtgacgaccttcagcttatcatgacccac
cagaagggtataaataataaagttatccatgaaatggcatgggatacttttgtaagctgt
accgaagttgccaaagagctgaagctatacggcgccggtcaggacttgctgtgtgatgcc
ttctccggaaacgtaaaaggcatggggcccggtgtagccgaaatggagattgatgaacgg
ccttcagaacctatcatcatcttcatggcagacaaaacctcatccggtgcttggaatctg
cctctttacaagatgtttgcagatccgtttaacactatcggtctggtcatagctgaaaac
atgcatgacggcttttcctttgaagttcatgacgtaaaggaaagcaagggtattaccttt
aatacccctgaagaaatttatgacctgctggtctttatcggcgctccttcccgctttgcc
ataaagagcgtctccacccgcaagggagagattgcggctgtttcctccacccagaagctg
gccctgctggccgggcgctacgtgggcaaagatgatccggtttgtattgtccgcgctcag
ggtgcattcccggctgtgggtgaaatacttgaacccttcactcagccctatctggtagaa
ggctggatgcgcggctcacacaacggccccattatgcctgtctcagtagaggacagcacc
cccacccgctttgacggcccgccccgggtaaccgctttgggcttccaactgtcaaacggc
atgcttattggcccgcgtgatatgttcaaggacaaatcctttgacaacgcccgtcagaag
tcactggacatggcagatatgatgcgctctcacggtccgtttgagccccatcgcctgccc
cttgaggaaatggaatataccaccatgcctcaggtatccaagaaactggccggacgcttt
aaacccctgaaagactag

DBGET integrated database retrieval system