KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_1034Help
Entry
DehaBAV1_1034     CDS       T00518                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
deb00010  Glycolysis / Gluconeogenesis
deb00030  Pentose phosphate pathway
deb00051  Fructose and mannose metabolism
deb00680  Methane metabolism
deb01100  Metabolic pathways
deb01110  Biosynthesis of secondary metabolites
deb01120  Microbial metabolism in diverse environments
deb01130  Biosynthesis of antibiotics
deb01200  Carbon metabolism
deb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehaBAV1_1034
   00030 Pentose phosphate pathway
    DehaBAV1_1034
   00051 Fructose and mannose metabolism
    DehaBAV1_1034
  Energy metabolism
   00680 Methane metabolism
    DehaBAV1_1034
Enzymes [BR:deb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     DehaBAV1_1034
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     DehaBAV1_1034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ABQ17614
JGI: DehaBAV11034
Position
1027406..1028503
Genome map
AA seq 365 aa AA seqDB search
MKVTLSVIKADIGGFVGHSDSHPQCLARAEKHLAEAKKKGMLIDYHITKCGDDLQLIMTH
QKGINNKVIHEMAWDTFVSCTEVAKELKLYGAGQDLLCDAFSGNVKGMGPGVAEMEIDER
PSEPIIIFMADKTSSGAWNLPLYKMFADPFNTIGLVIAENMHDGFSFEVHDVKESKGITF
NTPEEIYDLLVFIGAPSRFAIKSVSTRKGEIAAVSSTQKLALLAGRYVGKDDPVCIVRAQ
GAFPAVGEILEPFTQPYLVEGWMRGSHNGPIMPVSVEDSTPTRFDGPPRVTALGFQLSNG
MLIGPRDMFKDKSFDNARQKSLDMADMMRSHGPFEPHRLPLEEMEYTTMPQVSKKLAGRF
KPLKD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaccctgagtgttattaaagcagatatcggcggttttgtgggccattcggac
tcacacccgcagtgtctggccagagctgaaaagcatctggcagaagccaaaaagaagggc
atgctgattgattaccacataaccaagtgcggtgacgaccttcagcttatcatgacccac
cagaagggtataaataataaagttatccatgaaatggcatgggatacttttgtaagctgt
accgaagttgccaaagagctgaagctatacggcgccggtcaggacttgctgtgtgatgcc
ttctccggaaacgtaaaaggcatggggcccggtgtagccgaaatggagattgatgaacgg
ccttcagaacctatcatcatcttcatggcagacaaaacctcatccggtgcttggaatctg
cctctttacaagatgtttgcagatccgtttaacactatcggtctggtcatagctgaaaac
atgcatgacggcttttcctttgaagttcatgacgtaaaggaaagcaagggtattaccttt
aatacccctgaagaaatttatgacctgctggtctttatcggcgctccttcccgctttgcc
ataaagagcgtctccacccgcaagggagagattgcggctgtttcctccacccagaagctg
gccctgctggccgggcgctacgtgggcaaagatgatccggtttgtattgtccgcgctcag
ggtgcattcccggctgtgggtgaaatacttgaacccttcactcagccctatctggtagaa
ggctggatgcgcggctcacacaacggccccattatgcctgtctcagtagaggacagcacc
cccacccgctttgacggcccgccccgggtaaccgctttgggcttccaactgtcaaacggc
atgcttattggcccgcgtgatatgttcaaggacaaatcctttgacaacgcccgtcagaag
tcactggacatggcagatatgatgcgctctcacggtccgtttgagccccatcgcctgccc
cttgaggaaatggaatataccaccatgcctcaggtatccaagaaactggccggacgcttt
aaacccctgaaagactag

DBGET integrated database retrieval system