KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_1056Help
Entry
DehaBAV1_1056     CDS       T00518                                 

Definition
methionine sulfoxide reductase B (EC:1.8.4.11)
Orthology
K07305  
peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12]
Organism
deb  Dehalococcoides mccartyi BAV1
Brite
Enzymes [BR:deb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.12  peptide-methionine (R)-S-oxide reductase
     DehaBAV1_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1051128..1051502)
Genome map
AA seq 124 aa AA seqDB search
MKYNELSPQEEAVIVRKGTEPAFSGEYVNLFKDGTYVCRRCDAPLYRAKDKFHSGCGWPS
FDEELSGAVKRQPDPDGRRTEILCAACGGHLGHVFEGESFTPKDTRHCVNSLSIKLVPDN
GVNK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataatgaattaagccctcaggaagaagcagttatagttcgcaagggaaccgaa
ccggccttcagcggtgaatatgtaaatctgtttaaagacggcacatacgtttgccgccgg
tgtgatgcaccgctttaccgtgccaaagataagtttcattcaggttgcggctggcccagc
tttgacgaagagctatccggtgctgtcaaacgtcagcctgacccggacggacggcggact
gagatactgtgtgccgcctgcggcgggcatttggggcatgtctttgaaggggagagtttt
acccctaaagatacccgtcactgtgtaaattcgctttcaatcaagttagtgccagacaat
ggtgtcaataaatga

DBGET integrated database retrieval system