KEGG   Dehalococcoides sp. BAV1: DehaBAV1_1056Help
Entry
DehaBAV1_1056     CDS       T00518                                 

Definition
methionine sulfoxide reductase B (EC:1.8.4.11)
Orthology
K07305  
peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12]
Organism
deb  Dehalococcoides sp. BAV1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1051128..1051502)
Genome map
AA seq 124 aa AA seqDB search
MKYNELSPQEEAVIVRKGTEPAFSGEYVNLFKDGTYVCRRCDAPLYRAKDKFHSGCGWPS
FDEELSGAVKRQPDPDGRRTEILCAACGGHLGHVFEGESFTPKDTRHCVNSLSIKLVPDN
GVNK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataatgaattaagccctcaggaagaagcagttatagttcgcaagggaaccgaa
ccggccttcagcggtgaatatgtaaatctgtttaaagacggcacatacgtttgccgccgg
tgtgatgcaccgctttaccgtgccaaagataagtttcattcaggttgcggctggcccagc
tttgacgaagagctatccggtgctgtcaaacgtcagcctgacccggacggacggcggact
gagatactgtgtgccgcctgcggcgggcatttggggcatgtctttgaaggggagagtttt
acccctaaagatacccgtcactgtgtaaattcgctttcaatcaagttagtgccagacaat
ggtgtcaataaatga

DBGET integrated database retrieval system