KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_1157Help
Entry
DehaBAV1_1157     CDS       T00518                                 

Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DehaBAV1_1157
   01230 Biosynthesis of amino acids
    DehaBAV1_1157
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DehaBAV1_1157
   00030 Pentose phosphate pathway
    DehaBAV1_1157
   00051 Fructose and mannose metabolism
    DehaBAV1_1157
   00052 Galactose metabolism
    DehaBAV1_1157
  Energy metabolism
   00680 Methane metabolism
    DehaBAV1_1157
Enzymes [BR:deb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DehaBAV1_1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1134019..1134951
Genome map
AA seq 310 aa AA seqDB search
MIATVTLNPCLDKHIDVHGLVLYETNRWHRMSKYAGGKGIDVSRAVYEMGFDTIACGLLG
GEEGREIETLLTEQGLKYHFTPISQPTRSCFIIYDTKTRRQTNLNAPGPRIAPPELKMFY
EDLLRESAASSLIVMSGSVPPGVPSSVYFTLISHARKLGKQTILDTAGKYLREGLKAKPC
LVKPNIREAEELLGRKLETEAEIILAAKEIVRMGAGIAVISMGKKGLIACDGKQVIKASS
AYVRVKSTVGAGDSTVAGFAISLRRGDSLEEACRLGVAMGTAAVMTPGTELCHREDVQYW
LPRIKIRRLA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgattgccacggttactttaaacccctgcctggacaagcatatagatgtgcatggtttg
gtactatatgaaaccaaccgctggcatcgcatgtccaaatatgccggcggcaaagggata
gatgtttcacgtgccgtctacgaaatggggtttgatacaattgcctgcggtttgctgggg
ggagaggaagggcgggaaattgaaaccctgttgacagagcaagggctaaaatatcacttt
acccccataagccagcctacccgcagttgttttataatttacgataccaaaacccgccgc
cagactaatctgaacgcccccggtccgcgaatagctccgcctgaactaaaaatgttttat
gaagacctgctgagggaaagtgctgcttccagcctgattgttatgtcgggaagcgtgccg
ccgggagtgccgtcaagtgtctatttcacccttatcagccacgcccgcaaactgggcaaa
caaaccatactggataccgccggtaaatacctgcgggaagggctgaaggctaaaccctgt
ctggtcaagcccaacatccgcgaagcagaggaactgttgggcaggaaactggagactgag
gctgaaataatactggctgccaaagaaatagtccggatgggggcaggaatagcggtaatc
tccatgggtaaaaaggggctgatagcctgtgacggaaagcaagtaataaaggcaagttcg
gcttatgtgcgggtaaaaagtacggtgggagcaggggattcaaccgtggccggttttgct
atatcactccgccgcggagacagcctggaagaagcctgccgtttgggggtagctatgggc
acagctgccgtaatgactcccggtactgaactctgccaccgtgaagacgttcagtattgg
ctgccccggataaaaatccgccgtctggcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system