KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_1198Help
Entry
DehaBAV1_1198     CDS       T00518                                 

Definition
(GenBank) DNA-(apurinic or apyrimidinic site) lyase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
deb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:deb00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    DehaBAV1_1198
Enzymes [BR:deb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     DehaBAV1_1198
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     DehaBAV1_1198
DNA repair and recombination proteins [BR:deb03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     DehaBAV1_1198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS FbpA Auto_anti-p27 Zn_ribbon_SprT FANCI_HD1 Rad50_zn_hook DNA_ligase_ZBD
Motif
Other DBs
NCBI-ProteinID: ABQ17777
JGI: DehaBAV11198
Position
complement(1172100..1172912)
Genome map
AA seq 270 aa AA seqDB search
MPELPEVETVKNEIMPHLLGKKIIRMEALWAKTLCPPEADFNALASGTCVTGLSRRGKYI
IISLSSGLFISVHLKMSGGLTAIRAENGQAPRFTRAIFHLENGEQVYFTDIRKFGRITLL
AGLDSVLEKLGPEPLEETFTAGVFWHRLSGRKGPIKAVLLDQKVLAGVGNMYADEALFKA
CLNPLRSAESLSMAEVERLHSAIQSVLHKAIQNKGASVSTYHRPDGSKGGAQLEFNVAHR
RGESCPVCGAPITRQLIRQRACYFCPRCQS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattgcctgaagttgaaacggtaaagaatgaaataatgccccatttgctgggt
aaaaagataatccgcatggaagctttgtgggccaaaactctttgcccgcccgaagcggat
tttaacgcactggcatcaggtacatgtgtaaccgggctgagccgccgtggcaagtatatt
atcattagcctgagcagcgggttatttatcagtgtccacctgaaaatgagcggcggactg
acggcaatcagggctgaaaacggtcaagccccccgctttaccagagccattttccatctg
gaaaatggagagcaggtatattttaccgatatacgcaaattcgggaggataaccctgctt
gccggtttggactctgttttagaaaaactggggcctgaacctctggaggaaacttttacc
gccggtgtattttggcatcgtctctcagggcgcaaaggacctataaaagcggtactgctt
gaccagaaggtactggctggggtgggcaatatgtacgcagatgaagccctgtttaaagcc
tgcctgaacccgctccgttcggctgaaagcctgagtatggcagaggtggaaagactgcat
tcagctattcagtcagttttacataaagctatacaaaacaagggggcaagtgtcagcacc
tatcatcgccctgacggctcaaagggcggtgcccagctggagtttaatgttgcccatcgc
aggggcgaatcttgcccggtttgcggtgctcccataacccgccagctgatacgccagcga
gcctgttacttctgtccccgttgccagtcctga

DBGET integrated database retrieval system