KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_1274Help
Entry
DehaBAV1_1274     CDS       T00518                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
deb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
deb01100  Metabolic pathways
deb01110  Biosynthesis of secondary metabolites
deb01130  Biosynthesis of antibiotics
deb01230  Biosynthesis of amino acids
Module
deb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DehaBAV1_1274
Enzymes [BR:deb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DehaBAV1_1274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE His_biosynth ThiG
Motif
Other DBs
NCBI-ProteinID: ABQ17853
JGI: DehaBAV11274
UniProt: A5FPM3
Position
1247351..1248130
Genome map
AA seq 259 aa AA seqDB search
MILERIVTDNLPDLERRKMRLPLAKLQELVLDIPYPPIDMAMKLKGRQVRLIAEVKKASP
SKGIIRPDFDPVDIAGIYARNGASAISVLTEEHHFMGSLDNLKKIRESGVASKLPLLRKD
FIHDPYQVYESRLYGADAILLIVAMLSPERLQELLSLSHKLGMKCLVEVHTRSELEIALE
SNARIIGLNNRDLHTFKIDLTVTERLRPLIPPECIVVSESGIQTRADISRLEELGVDAVL
VGEALTASVDIAAKMRKLL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgattttggaacgtattgtcaccgacaacctgcctgatttggagcggagaaaaatgcgg
ctgccattagcaaaactgcaggaattggtactggacataccctatccacccattgacatg
gccatgaagcttaaagggcggcaggtcaggctgattgccgaggtaaaaaaagcctctccg
tcaaaagggataatccgcccggattttgacccggtggatattgccggcatatatgcccga
aacggggcttccgccatttcggttttgacagaagaacaccattttatgggaagccttgac
aacctgaagaaaatacgcgaatcaggggtggcatcaaagctgccgcttctccgtaaggat
tttatccatgacccgtatcaggtatatgaatcccgcctgtacggggcagacgctattttg
ctgatagtagccatgctgtctcccgaaaggttacaggaactgctttcactcagccataag
ctgggcatgaaatgtctggtggaagtgcatacccggtcagagctggaaatagctttagag
agtaatgcccggattatcggcctgaataaccgtgatttgcatacgtttaaaatagaccta
actgtaaccgaaaggcttcgccccctgataccccctgagtgcatagttgtcagtgaaagc
ggcattcagaccagagcagatatttcccgtctggaagaactgggagtagatgcagtgctg
gtaggagaagccttaacagcctcggttgatattgccgccaaaatgaggaaactgctgtga

DBGET integrated database retrieval system