KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_1277Help
Entry
DehaBAV1_1277     CDS       T00518                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DehaBAV1_1277
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DehaBAV1_1277
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DehaBAV1_1277
Enzymes [BR:deb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DehaBAV1_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
1249790..1250989
Genome map
AA seq 399 aa AA seqDB search
MPKVDSTGKPGYFGKYGGQFVPEILVPVLNELEQAYEQAKKDETFQSRLKSLSNTFSGRP
TPLYLAERLTEHLGGARIYLKREDLAHTGAHKINNALGQGLLALHMGKKRVIAETGAGQH
GVATAAVCAMLGLECIVYMGEDDIKRQALNVFRMKLMGTEVRSVSSGSRTLKDAINEAMR
DWVSNPETTYYIIGSVVGPRPYPAMVRDFQAVIGQETKAQSLRQLGGLPDCIVACVGGGS
NAMGIFYDFIPDQSVRLIGVEAAGSGISTGKHSATLSAGKVGILHGAMSYLLQDEHGQVI
ETHSISAGLDYPGVGPEHSYLKDNKRVEYVSVTDEEALNGFKLLCSLEGIMPALESSHAI
AHALKIAGGMPKNKNIVINLSGRGDKDMDIVQKAMGVKI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagtagatagcaccggtaaaccggggtatttcggcaagtatggcgggcagttt
gtacctgaaatactggtgccagtcctaaacgaactggaacaggcttatgaacaagccaaa
aaagacgagactttccagtcacgcctgaaatccctttcaaacaccttttcggggcggccc
actccgctgtatctggcagaaaggctgactgaacatctggggggtgccagaatttacctg
aaaagggaagacctggcccatacaggtgcccataaaatcaacaacgcactcggtcagggg
ctgcttgccttgcatatgggaaagaaaagggtaattgccgaaacaggggcggggcaacac
ggggtagccaccgcagctgtttgcgccatgctggggctggaatgcattgtctatatgggc
gaagatgacatcaaacgtcaagccttgaacgtattccgcatgaagctgatgggaacggaa
gtcagaagcgtatcttcgggcagccgtaccctgaaagacgccatcaatgaagctatgcgt
gactgggtaagcaacccggagaccacttattatataatcggttcggtggtcggcccgcgc
ccttatccggctatggtacgggattttcaggcagttatcgggcaggaaaccaaagcccag
tccttaagacagctggggggactacctgactgcattgttgcctgtgttggcggaggcagc
aatgccatgggtattttctatgatttcataccagaccaaagcgtacgtcttatcggggtg
gaagctgccggcagcggcatcagcaccggcaaacattcagccacccttagtgccggcaag
gtgggtatactccacggcgccatgtcctacctgcttcaggacgagcatggacaggtgatt
gaaacccacagtatttcggccgggctggattatcccggcgtaggccctgaacacagctac
ctgaaagataataagcgggtggaatatgtttcggtcacagatgaagaagccctgaacggc
ttcaaactgctctgctcgctggaagggataatgcctgctctggaatcttcccacgccatt
gcccatgccctgaaaatagcaggcggcatgccgaaaaacaaaaatatagtcataaacctc
tccggcagaggggacaaagacatggatattgttcaaaaagcaatgggggtaaagatatga

DBGET integrated database retrieval system