KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_1278Help
Entry
DehaBAV1_1278     CDS       T00518                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DehaBAV1_1278
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DehaBAV1_1278
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DehaBAV1_1278
Enzymes [BR:deb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DehaBAV1_1278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1250986..1251753
Genome map
AA seq 255 aa AA seqDB search
MSRISDAFQKRKSLIAYITVGYPDIETTLRLVPLLEENGVDIIELGIPFSDPLADGVTIQ
NASYQALQNGVTPEVCLSVAALLKEKISIPMVFMGYYNPIYNYGLTKFCQKCATAGVSGF
IIPDLPPGEAQDIDFAAREAGLDIIFLLAPTSTDERIKLVAAKSRGFIYLVSHSGVTGAT
ANLPADLSSFVNRVRKTARQPLAVGFGISTPEQAQNIAKFSDGIIVGSRILQLVQTDPSL
EKVATFIRQLRQSLD
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtatcagtgatgcattccaaaaacgaaaatctcttatagcttacataacagtc
ggctacccggatattgaaaccaccctgcggctggtgcctctgctggaagaaaacggggtg
gatattatagagctgggtattcccttctcagacccgctggcagacggagttactattcaa
aatgccagttatcaggcactccagaacggggtgacgcctgaagtctgtttatctgttgcc
gccctgctcaaagaaaaaatctccatacccatggtattcatgggctattataatcccatt
tacaactacggactgaccaagttctgccaaaagtgtgcaactgcgggtgtaagcggattt
attattcctgacctgccgccgggagaagcccaagacatagactttgccgccagagaagcc
ggcttggatataatctttctgttagcccccaccagtaccgacgaacggattaagctagtt
gccgccaaatcacgggggtttatttatctcgtttcccactcaggcgttaccggggcaact
gccaacttgccggctgatttgagcagttttgtaaacagggtaaggaaaaccgcccgccag
cctctggcagtgggctttggtatttcaacccccgaacaagcccaaaatatcgcaaaattt
tccgacgggataatagtaggcagccgtatcctgcagcttgtccagacagacccttcactt
gaaaaagtagccacatttatcaggcaactcagacaatcattagactaa

DBGET integrated database retrieval system