KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_1278Help
Entry
DehaBAV1_1278     CDS       T00518                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
deb00260  Glycine, serine and threonine metabolism
deb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
deb01100  Metabolic pathways
deb01110  Biosynthesis of secondary metabolites
deb01130  Biosynthesis of antibiotics
deb01230  Biosynthesis of amino acids
Module
deb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DehaBAV1_1278
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DehaBAV1_1278
Enzymes [BR:deb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DehaBAV1_1278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ABQ17857
JGI: DehaBAV11278
UniProt: A5FPL3
Position
1250986..1251753
Genome map
AA seq 255 aa AA seqDB search
MSRISDAFQKRKSLIAYITVGYPDIETTLRLVPLLEENGVDIIELGIPFSDPLADGVTIQ
NASYQALQNGVTPEVCLSVAALLKEKISIPMVFMGYYNPIYNYGLTKFCQKCATAGVSGF
IIPDLPPGEAQDIDFAAREAGLDIIFLLAPTSTDERIKLVAAKSRGFIYLVSHSGVTGAT
ANLPADLSSFVNRVRKTARQPLAVGFGISTPEQAQNIAKFSDGIIVGSRILQLVQTDPSL
EKVATFIRQLRQSLD
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtatcagtgatgcattccaaaaacgaaaatctcttatagcttacataacagtc
ggctacccggatattgaaaccaccctgcggctggtgcctctgctggaagaaaacggggtg
gatattatagagctgggtattcccttctcagacccgctggcagacggagttactattcaa
aatgccagttatcaggcactccagaacggggtgacgcctgaagtctgtttatctgttgcc
gccctgctcaaagaaaaaatctccatacccatggtattcatgggctattataatcccatt
tacaactacggactgaccaagttctgccaaaagtgtgcaactgcgggtgtaagcggattt
attattcctgacctgccgccgggagaagcccaagacatagactttgccgccagagaagcc
ggcttggatataatctttctgttagcccccaccagtaccgacgaacggattaagctagtt
gccgccaaatcacgggggtttatttatctcgtttcccactcaggcgttaccggggcaact
gccaacttgccggctgatttgagcagttttgtaaacagggtaaggaaaaccgcccgccag
cctctggcagtgggctttggtatttcaacccccgaacaagcccaaaatatcgcaaaattt
tccgacgggataatagtaggcagccgtatcctgcagcttgtccagacagacccttcactt
gaaaaagtagccacatttatcaggcaactcagacaatcattagactaa

DBGET integrated database retrieval system