KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_1328Help
Entry
DehaBAV1_1328     CDS       T00518                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
Organism
deb  Dehalococcoides mccartyi BAV1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(1292323..1293312)
Genome map
AA seq 329 aa AA seqDB search
MKVLVSGASGRIGNVLVRELLKSGYGVRALVKPGDTALSIQGLDIERVEGDVTVYPSVLD
GLKGCEAVFYLAGIVSIIPGREKELYETNIKGAANMADACLECGITRLLYTSSIHALSEP
PPGTAFTEEEGYHPSDFPPGYNRSMAQGALEVLKRFSAGLSGVIVCPSGVIGPYDYDPSE
MGRVVVDYARGKMSAYVDGGYDFVDVRDVAIGMISAFEKGQDGQSYILSGQYVSIKSLFE
ILGRLSGLTPPRLRVPYILAKLGAYISYPYYRLTHSAPLFTAYSLDVLRSNSNISSAKAR
CELGFSPRLAEESLADAYLWFKSKGYLSD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattagtcagcggggcttccggccgtatcggcaacgtgctggtcagggagcta
ctgaaatccggctacggggtaagagctttggtgaagccgggagataccgccctgtctatt
caggggcttgatattgaacgggtggagggtgacgtaaccgtttatccctctgttttggac
gggctaaaagggtgtgaggctgttttttatctggcgggtattgtttccataataccgggg
cgggaaaaagagctttatgaaaccaatataaaaggggcagccaatatggctgatgcctgt
ctggagtgcggaataacccgcctgctttatacttcttcaatccatgccctgtccgaacct
cccccggggacagcttttactgaagaagagggatatcatccgtctgatttcccgccgggt
tacaaccggagtatggctcagggggctctagaggtgcttaagagattttcagccgggctt
tcaggtgttattgtctgccccagtggggttatcggtccgtatgactatgatccttcagaa
atgggcagagtagtggtggactacgccagggggaaaatgagtgcttatgtagacgggggc
tacgatttcgtagatgtacgggatgtagctataggcatgatatccgcctttgaaaagggg
caggacgggcagagttatatactctccggccagtacgtcagcattaagagtttgtttgaa
atactgggcaggcttagcgggcttactcctccccgtctccgagtaccttatattcttgcc
aaactgggtgcttatatcagttatccgtattaccgcctgacccatagcgcccctcttttt
acagcatattcgttagatgtactgcggagcaattccaatatcagttctgccaaagcccgc
tgtgaactggggttctccccccgtctggcggaggaatctctggcagacgcatatttgtgg
ttcaaatccaagggttatttaagtgattaa

DBGET integrated database retrieval system