KEGG   Dehalococcoides sp. BAV1: DehaBAV1_1349Help
Entry
DehaBAV1_1349     CDS       T00518                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
deb  Dehalococcoides sp. BAV1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:deb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1309246..1310094
Genome map
AA seq 282 aa AA seqDB search
MNLPITKPVSSHFGSKQFGWGERTYIMGIVNVTPDSFSGDGLGANPEAALEQARRFVKEG
ADILDIGGESTRPNCPPVSTEEELGRVILAIRLIVRNLDIPISIDTYRREVAEEALKAGA
CIVNDVWGLQKDPSLFELAAKSRSGWVITSNQREHPVEDIMEAVICELKSTALKLLERGV
PAQNIIIDPGVGFGKTLEQNLEIVRRLSELKTLNLPVLLGTSRKSLIGQVLDTPPNERLE
GTAATVALGIGGGVDIVRVHDVARMRRVCQMSDAVIRGKIWK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacccattacaaaacccgtaagcagccacttcggctcaaagcaatttggctgg
ggagagcgtacctatataatgggcattgtaaatgtcactccggactcattttcgggtgac
ggactgggtgctaaccccgaagcggcactggaacaggcccgccgctttgtaaaagaaggg
gcggatatactggatataggcggtgaaagtacccgcccgaactgcccgcctgtaagcacc
gaagaagaactggggcgggtaattctggctatacgtcttatagtgcggaatctggatatc
cccataagcatagatacctaccgccgtgaagtggctgaggaagccctgaaggcgggtgcc
tgcatagtaaatgatgtctggggtttacaaaaagacccttcactttttgaactggcggcc
aaaagccgatctggctgggtaataacctctaaccagcgggaacaccctgtggaagacatt
atggaggcagtcatctgcgaactgaaatctaccgccctgaaactgctggagcggggtgta
ccagcccaaaatattataattgacccgggggtgggtttcggtaaaactttggaacagaat
ctggagattgtccgccgtctgtcagaactgaaaacccttaatctgcctgtactgctgggt
acttcccgcaaatccctgatagggcaggtgctggataccccacctaacgaacggcttgaa
ggcacggccgccaccgttgccctggggatagggggaggggtggatattgtaagggtgcat
gacgtggcccggatgagacgggtctgccagatgagcgatgctgttataaggggtaaaata
tggaaataa

DBGET integrated database retrieval system