KEGG   Dehalococcoides mccartyi BAV1: DehaBAV1_1350Help
Entry
DehaBAV1_1350     CDS       T00518                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
deb  Dehalococcoides mccartyi BAV1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:deb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DehaBAV1_1350
Enzymes [BR:deb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     DehaBAV1_1350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1310085..1310612
Genome map
AA seq 175 aa AA seqDB search
MEIIYLGLGSNTGTREQYLKDAQTRLSEKIVITSCSTIYETEPLNCPPQTNFLNMVIEAR
TELSPPDLLAFTQKVEKEMGRSQNSHNQPRLIDIDILLYGQKRLNTPTLTIPHPHLTERA
FVMLPLVELAADFIYPGSRSSLSDLLEELPSGQSIRPFSYLPEDSRDDYDDDEDE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggaaataatatatttgggactggggtcaaacaccggaacccgtgaacaatacctgaaa
gatgcccagacccgtctttcagaaaaaatcgttatcaccagctgttccactatatatgaa
accgaaccgctgaactgccctccccagacgaactttttaaatatggttatagaagcccgc
acagagctttcacctccggaccttttggcatttacccaaaaggtggaaaaagagatgggc
cgaagccaaaacagccataaccagccccgcctaatagatattgatatcctgctgtacggc
caaaaacgcttaaatacgcccaccctgaccatacctcatccccacttgaccgaaagggct
tttgtaatgttaccgctggtggaactggcagctgattttatctacccgggcagccgctcc
agcctgtcggatttgcttgaggaactgccttccggccagtctatccgtccgttttcatac
ctgcctgaggacagcagagacgattatgacgacgacgaggacgaataa

DBGET integrated database retrieval system