KEGG   Dehalobacter sp. CF: DCF50_p1146Help
Entry
DCF50_p1146       CDS       T02279                                 

Definition
Phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dec  Dehalobacter sp. CF
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DCF50_p1146
   00030 Pentose phosphate pathway
    DCF50_p1146
   00051 Fructose and mannose metabolism
    DCF50_p1146
   00052 Galactose metabolism
    DCF50_p1146
   00500 Starch and sucrose metabolism
    DCF50_p1146
   00520 Amino sugar and nucleotide sugar metabolism
    DCF50_p1146
  Nucleotide metabolism
   00230 Purine metabolism
    DCF50_p1146
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DCF50_p1146
Enzymes [BR:dec01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     DCF50_p1146
    5.4.2.8  phosphomannomutase
     DCF50_p1146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1202133..1203551)
Genome map
AA seq 472 aa AA seqDB search
MKNEFFKNMFREYDIRGRVSENEFNTNNVALITKAFITYLIQRGINQVVVGYDNRSYSEE
FAETAITQFTDSGFIVYDIGLTLSPIAYFAQYYFKCHGLMMITASHNPNGWSGFKLGDGY
SKTIGPEEISEIYENLLNNNFLTLDSPGERKKISVREEYIESIISRIRMSDYKPKIVIDG
GNGGAGLFAYEIFQKLGCMTFQLNCDPDTNYPHYFPNPSDLKARERLAEMVIHPYINADL
GLSFDGDGDRLGVTDQNGENVWSDRILIILARQLLEKKKGAKIVFDVKCTQGLSEDILEH
GGEPIMWKTGHSHIKTKMRMEKADLAGERSGHIFIANEYYGFDDALYAGAKLVEYLSNQN
KSLIEVLHDIPQYVTSPEIKAHCSDSDKYKVVDALSEIFKKEYRDNVIDINGARVVYDDG
WGLVRASSNLPELVLIFEAKTKERLLEIRSIFKEKINQFQEVDMNWQNDFIM
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaatgaatttttcaaaaatatgtttagagagtatgatattcgaggtagggtatcc
gaaaatgagtttaatactaataatgtggcattgataacaaaagcttttattacttacttg
attcaaagaggtattaatcaagtggtagttggttacgataatcgaagttattcagaagaa
tttgcggaaacggctattacccaattcactgacagtggcttcattgtttatgacatcggt
ttaacacttagccctattgcttattttgcccagtattactttaaatgccatggtttaatg
atgattacagcaagtcataatccgaatggctggtcagggtttaaattaggagatggttat
tccaaaacaatcggacctgaagaaatatctgagatatacgaaaatttactgaataacaat
ttccttacgttagatagccctggagaaagaaaaaaaatctctgttcgggaagaatatatt
gagtcgattatcagtaggataagaatgtctgactataagccaaagattgtcatagatggt
ggaaatggcggagcaggcttatttgcttatgaaatatttcaaaaactagggtgtatgaca
ttccagttgaactgtgaccccgacacaaactatccgcattatttcccaaatccatctgat
cttaaagccagagaaagactcgcagaaatggttattcatccctatatcaatgcagatctt
ggcttgtcatttgatggagatggagaccgattaggggttaccgatcaaaatggagaaaac
gtctggagtgatcggatattaataattttggctagacaactgttggagaaaaaaaaaggt
gcaaagattgtatttgatgttaagtgtacccagggcttaagtgaagatattttggaacac
ggcggcgagcccataatgtggaaaaccggtcattctcacatcaagacaaaaatgcgcatg
gaaaaggcagatctagcaggggaaagaagcggacatatctttattgctaatgagtattat
ggttttgatgatgccctttatgctggagctaagttggttgaatatttatcaaatcagaat
aaatccttgattgaggtattgcatgatattccgcaatatgttacttctcctgaaataaaa
gctcattgcagcgattcagataaatacaaagttgttgatgcattatcggaaatctttaaa
aaagaatacagggataatgttattgatataaatggtgcacgtgttgtttatgatgacgga
tggggattggttagggcatcttcgaatttgccagagctagttcttattttcgaggccaag
acaaaagaaaggcttcttgagataagaagtatctttaaagaaaaaattaatcaatttcaa
gaagttgatatgaattggcaaaatgattttattatgtaa

DBGET integrated database retrieval system