KEGG   Dehalobacter sp. CF: DCF50_p1146Help
Entry
DCF50_p1146       CDS       T02279                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dec  Dehalobacter sp. CF
Pathway
dec00010  Glycolysis / Gluconeogenesis
dec00030  Pentose phosphate pathway
dec00051  Fructose and mannose metabolism
dec00052  Galactose metabolism
dec00230  Purine metabolism
dec00500  Starch and sucrose metabolism
dec00520  Amino sugar and nucleotide sugar metabolism
dec00521  Streptomycin biosynthesis
dec01100  Metabolic pathways
dec01110  Biosynthesis of secondary metabolites
dec01120  Microbial metabolism in diverse environments
dec01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DCF50_p1146
   00030 Pentose phosphate pathway
    DCF50_p1146
   00051 Fructose and mannose metabolism
    DCF50_p1146
   00052 Galactose metabolism
    DCF50_p1146
   00500 Starch and sucrose metabolism
    DCF50_p1146
   00520 Amino sugar and nucleotide sugar metabolism
    DCF50_p1146
  Nucleotide metabolism
   00230 Purine metabolism
    DCF50_p1146
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DCF50_p1146
Enzymes [BR:dec01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     DCF50_p1146
    5.4.2.8  phosphomannomutase
     DCF50_p1146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV DUF5055
Motif
Other DBs
NCBI-ProteinID: AFV05151
UniProt: K4L3M5
Position
complement(1202133..1203551)
Genome map
AA seq 472 aa AA seqDB search
MKNEFFKNMFREYDIRGRVSENEFNTNNVALITKAFITYLIQRGINQVVVGYDNRSYSEE
FAETAITQFTDSGFIVYDIGLTLSPIAYFAQYYFKCHGLMMITASHNPNGWSGFKLGDGY
SKTIGPEEISEIYENLLNNNFLTLDSPGERKKISVREEYIESIISRIRMSDYKPKIVIDG
GNGGAGLFAYEIFQKLGCMTFQLNCDPDTNYPHYFPNPSDLKARERLAEMVIHPYINADL
GLSFDGDGDRLGVTDQNGENVWSDRILIILARQLLEKKKGAKIVFDVKCTQGLSEDILEH
GGEPIMWKTGHSHIKTKMRMEKADLAGERSGHIFIANEYYGFDDALYAGAKLVEYLSNQN
KSLIEVLHDIPQYVTSPEIKAHCSDSDKYKVVDALSEIFKKEYRDNVIDINGARVVYDDG
WGLVRASSNLPELVLIFEAKTKERLLEIRSIFKEKINQFQEVDMNWQNDFIM
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaatgaatttttcaaaaatatgtttagagagtatgatattcgaggtagggtatcc
gaaaatgagtttaatactaataatgtggcattgataacaaaagcttttattacttacttg
attcaaagaggtattaatcaagtggtagttggttacgataatcgaagttattcagaagaa
tttgcggaaacggctattacccaattcactgacagtggcttcattgtttatgacatcggt
ttaacacttagccctattgcttattttgcccagtattactttaaatgccatggtttaatg
atgattacagcaagtcataatccgaatggctggtcagggtttaaattaggagatggttat
tccaaaacaatcggacctgaagaaatatctgagatatacgaaaatttactgaataacaat
ttccttacgttagatagccctggagaaagaaaaaaaatctctgttcgggaagaatatatt
gagtcgattatcagtaggataagaatgtctgactataagccaaagattgtcatagatggt
ggaaatggcggagcaggcttatttgcttatgaaatatttcaaaaactagggtgtatgaca
ttccagttgaactgtgaccccgacacaaactatccgcattatttcccaaatccatctgat
cttaaagccagagaaagactcgcagaaatggttattcatccctatatcaatgcagatctt
ggcttgtcatttgatggagatggagaccgattaggggttaccgatcaaaatggagaaaac
gtctggagtgatcggatattaataattttggctagacaactgttggagaaaaaaaaaggt
gcaaagattgtatttgatgttaagtgtacccagggcttaagtgaagatattttggaacac
ggcggcgagcccataatgtggaaaaccggtcattctcacatcaagacaaaaatgcgcatg
gaaaaggcagatctagcaggggaaagaagcggacatatctttattgctaatgagtattat
ggttttgatgatgccctttatgctggagctaagttggttgaatatttatcaaatcagaat
aaatccttgattgaggtattgcatgatattccgcaatatgttacttctcctgaaataaaa
gctcattgcagcgattcagataaatacaaagttgttgatgcattatcggaaatctttaaa
aaagaatacagggataatgttattgatataaatggtgcacgtgttgtttatgatgacgga
tggggattggttagggcatcttcgaatttgccagagctagttcttattttcgaggccaag
acaaaagaaaggcttcttgagataagaagtatctttaaagaaaaaattaatcaatttcaa
gaagttgatatgaattggcaaaatgattttattatgtaa

DBGET integrated database retrieval system