KEGG   Dehalobacter sp. CF: DCF50_p1496Help
Entry
DCF50_p1496       CDS       T02279                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dec  Dehalobacter sp. CF
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dec00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:dec00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1530265..1531743)
Genome map
AA seq 492 aa AA seqDB search
MSSSEKTLAEIIDGMKQVEVLGDTQTVINGITHDSRTVSPGNLYVCIRGYQADGHAFAEA
AVRASATALAVEEFLPLAVPQLKFTDTRKAMGFLAAEVFGNPSDRLELVGVTGTNGKTTV
THLIERIVQQSGKKTGLIGTLGSRIGNNAYPGQHTTPESTEIQLLLAEMVAENVDLAVME
VSSHALDLGRVNGCVFNAGIFTNLTQDHLDYHKDMQEYLKVKALLFSGLNGGKAGQLAVL
NADDVSCVFLKEQAGCRAVTYGVDHEADYRAVNIRLSDRGVEFDVIFHGKSAEIFYSTPG
KFSVYNVLAAIAWALESGYPTEIVVQALHSIKGVPGRFESIRKGQPFLVIVDYAHTPDGL
ENVLRTAREITAGKLITVFGCGGDRDRKKRPLMGEAAGRFSDYIVVTSDNPRTEDPDKII
EDIIPGLKSANYKVIKDRCSAIDEACTAAGSGDTVLIAGKGHEDYQILGTEKIHFDDREE
ADKVLRRLGYVE
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtctagttctgaaaaaacgctggcggaaatcattgacggtatgaaacaggttgaagtg
cttggagatacgcagacggtaattaatgggatcacccatgactcaagaacggtatctcca
ggcaatctatatgtatgcattagaggttatcaggcggacggtcatgcgtttgccgaggct
gcggtccgggccagcgctacagcgttagccgtggaggagttcctgccgctagccgtaccc
cagcttaaatttacggatacccggaaggccatgggttttttagcggctgaggtcttcggg
aatccatccgaccggcttgaacttgtcggtgtaaccgggacgaacggtaaaaccacagtg
acgcacctgattgagcggatcgttcagcaaagcggcaagaaaactggtctgatcggtaca
cttggcagcagaataggaaacaatgcgtatcccggccagcataccacgcctgaatcgacg
gaaattcaacttttattagctgaaatggttgcggaaaatgtggatctcgccgtgatggaa
gtatcctcgcatgcactcgatttgggaagagtcaatggctgtgtattcaatgccgggatt
tttaccaatctgacacaggatcatttggattaccataaggatatgcaggaatacctcaaa
gtgaaagcgctacttttctccggcttgaacggcggaaaagccggccagctggctgtgctc
aatgctgacgacgtctcctgtgtctttctgaaagaacaggcgggttgcagggcagtcacg
tatggtgttgaccacgaggcggactaccgggctgtgaatatccggctttcagacagaggt
gttgaatttgacgtgatttttcacgggaaaagcgccgagattttttatagtacccctggt
aaatttagtgtttacaatgttctggccgcaattgcctgggcactggaaagcggatatccg
actgagattgtggtgcaagcgcttcacagtatcaaaggggttccgggcagatttgagagt
attcgcaaaggccagccttttttagttattgtcgattatgcacatacaccggacggcctg
gaaaatgttttgcgtacggccagagaaatcactgctggaaagctgatcacagtatttggc
tgcggcggtgacagggaccgaaaaaaaaggccgctcatgggagaagccgccggccgtttt
agcgactatattgtcgtaacctcggataatccccggactgaagatcctgataaaattatt
gaagatattattccggggcttaaatcagccaattacaaggtgataaaagaccgctgcagt
gcgatcgacgaagcctgtacggcagccggttccggggacacggtacttatcgccggcaaa
ggacatgaagactatcagattctaggcacggaaaaaatacattttgatgaccgggaagaa
gcagataaagttcttaggagattgggttatgtggaatag

DBGET integrated database retrieval system