KEGG   Dehalobacter sp. CF: DCF50_p2210Help
Entry
DCF50_p2210       CDS       T02279                                 

Definition
dipeptidase, putative
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dec  Dehalobacter sp. CF
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DCF50_p2210
  Amino acid metabolism
   00300 Lysine biosynthesis
    DCF50_p2210
Enzymes [BR:dec01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     DCF50_p2210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2268662..2270062
Genome map
AA seq 466 aa AA seqDB search
MKGLKDAIDSFKEDLIHSVQDCIRIKSVSSDHDGTQKALEYYLALAHSMGFSTHNVENLG
GVIEYGEGEKTYGMIVHLDTVPEGSGWKFPPFGGLIQEGKIYGRGAIDDKGPALSALYAL
KALKDSGSGISSECKVQIIIGIDEEGIWNTTPKLLKKIKEPDFSFVPDSKFPVVIAEKGL
VWLEIKKKLSQESSGNSGITIETMQGGGQSLNIVPDYCEATLRLNDDQKTQTKEELKLFQ
EQTGYDISLEKNASVCKLISKGKSAHAFICNEGRNAISQLIMFLSLLELEGGQKEFIQAY
AQSMAMEYYGESLGLSLEDQLTGKLTVNPGYILIDENNITLKVDIRFPAKERLDIIKPKI
ERAFSGFQGNLTIIDSLESLSFPEDDPNIRRLIQVYQDFTGDTEAKPLGMGGTTFSKAFK
RAVAFGPTFPGMPKVEHQPDEYMEIEHLIKCTEIYALALQSLVRNE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggttaaaagatgccatagattcttttaaagaagatttgattcattctgtgcaa
gactgcattcggattaaaagtgtctctagcgatcacgatggtacccaaaaggccttggag
tattaccttgccctggctcatagcatgggattttcgacacataacgtagaaaacctgggc
ggagtaatcgaatatggagaaggggaaaaaacctacgggatgattgttcatcttgatact
gtccctgagggaagtggctggaaattcccccctttcggaggtctgattcaagaaggaaaa
atttatggccggggcgcaatcgatgacaaagggccggcgctctcagccctctatgcttta
aaagccttaaaggattccggatcaggaattagctctgaatgtaaggttcagattattatt
ggaattgatgaagagggcatctggaatacaacacctaaattattaaaaaaaattaaagaa
cctgatttttcttttgttcccgattcgaaattcccggttgttattgccgagaagggcctg
gtctggctggaaatcaagaaaaaattaagtcaggaatcctccggcaatagtgggattacg
attgaaaccatgcaagggggaggacagtccctcaatattgttcctgattactgcgaagct
acacttagattgaatgatgaccaaaaaacacagaccaaagaggaactcaagctattccaa
gaacaaacaggatatgatatctctcttgaaaaaaatgcttctgtttgcaaacttatatcc
aagggaaaatccgcccatgcctttatctgcaatgaaggacgaaatgccatttcccagctc
attatgtttttaagtctgctggagcttgaaggcgggcaaaaggagttcatccaagcctat
gcccaaagcatggcaatggaatattatggtgaatccctgggcctcagtcttgaagatcaa
ctgacaggtaaacttactgttaaccccgggtatatcctgattgacgagaataacattacc
ctgaaggtggatattcgtttcccggctaaggagcggcttgacataatcaaacctaaaatc
gagagagcctttagcggtttccagggaaacctcacaatcatcgattcactggaatctttg
agtttcccggaagatgatcccaatattcgtagactcatacaggtctatcaggattttact
ggagacactgaagcaaaacctctgggaatgggcggaaccactttttccaaagctttcaaa
cgcgcagttgcctttggtccgacttttcccgggatgcctaaagttgagcaccagcctgat
gaatatatggagattgaacatcttatcaagtgcactgagatctacgccctagcacttcaa
tcacttgtcagaaacgaataa

DBGET integrated database retrieval system