KEGG   Dehalobacter sp. CF: DCF50_p2327Help
Entry
DCF50_p2327       CDS       T02279                                 

Gene name
cheB
Definition
Chemotaxis response regulator protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dec  Dehalobacter sp. CF
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:dec02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:dec02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2398700..2399719)
Genome map
AA seq 339 aa AA seqDB search
MAKKKIRVLIVDDSIVFREILARGIASDPEIEVVGMAADPFEARDKILEVEPDVMTCDVQ
MPKMNGIEFICKLLPQYPIPVIVISTVSDAVFDAMNAGAVEFVGKPDMKAAQRVETFLNE
LKIKIKVASVARIIPSMKDTTEKVESQHAENSEKIIAIGASTGGTEAVCNIMKRLPANMP
GIVIVQHIPPVFSRMFAERLNNQTKLKVKEARTGDYLEQGMALVAPGDQHVRIKKIANRY
RIECFAGEKVNGHCPSVDVLFESVAKEAGKNALGVILTGMGYDGAKGLLQMRRKGARTIG
QDQDSCVVYGMPKVAHDIGAVERQTSLMNIPQLICTMLK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaaaaagattagggttttaattgtagatgattccatcgttttccgggagatt
ctggccagaggaatcgccagtgacccggagatcgaagttgtgggtatggccgcagacccg
tttgaagccagggataaaatcctggaagttgaaccggacgtgatgacctgtgatgtccag
atgcccaaaatgaacgggattgaatttatctgcaagctgctgccgcaatatccgattccg
gtgattgtgatcagtacggtgagcgatgctgtttttgatgcgatgaatgccggggctgtc
gaatttgtcggcaagccggatatgaaggctgcgcagagagtggaaacctttttaaatgag
ttgaagattaagatcaaggtagcctccgtcgcccggattatcccgtcgatgaaggatacg
actgaaaaagttgaaagccagcatgccgagaattcggaaaaaatcattgcgatcggcgct
tccaccggcggaacggaagccgtctgcaatatcatgaagcgactgcctgcgaatatgccc
gggatcgttatcgtccagcatatccctcctgttttttcccggatgtttgccgagcggctg
aataatcagaccaaactgaaggtcaaggaagctcggaccggggattacctggaacaggga
atggccttagttgcgcctggagaccagcatgtcagaatcaaaaagatagccaatcgatac
aggattgagtgcttcgcaggagaaaaggtcaacggtcattgtccttccgtcgatgtctta
tttgaatctgtggccaaggaagcaggcaaaaatgcgctgggtgtcattttgaccggtatg
ggatatgacggggccaagggactcctgcagatgagaagaaaaggggccagaacgatcggt
caggatcaggattcctgtgtggtctacggcatgccgaaagttgctcatgatatcggggcc
gttgaaagacaaacttctttaatgaacatccctcagttgatttgtacgatgctgaagtaa

DBGET integrated database retrieval system