KEGG   Dehalobacter sp. CF: DCF50_p2707Help
Entry
DCF50_p2707       CDS       T02279                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dec  Dehalobacter sp. CF
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DCF50_p2707
   00052 Galactose metabolism
    DCF50_p2707
   00500 Starch and sucrose metabolism
    DCF50_p2707
   00520 Amino sugar and nucleotide sugar metabolism
    DCF50_p2707
Enzymes [BR:dec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DCF50_p2707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2790903..2791859)
Genome map
AA seq 318 aa AA seqDB search
MQKIRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVQSGIEDVIIVTGRN
KRAIEDHFDRSVELELFLKNGEKSELLDMVKHIAEMVDIHYVRQKEALGLGHAVYSARRF
IGNEPFAVLLGDDVIYSDEPCLKQMIRYYELYNSNLIGVQEVLPAEVSKYGIIDGSRISP
RLYKAEAMFEKPAPEEAPDIPLAIMGRYILNPEIFDILAELPPGRNGEIQLTDAIAQLSK
VQDVYAYNFEGKRYDVGDKLGFVRATIEFALRHEEIGESLMDYLTDIVSRYQKEGQELRL
LSAGNNLDKLYDIKKNYS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgcagaaaattcgtaaagcagtcatacccgcggctggattgggtacaagatttcttcct
gcgaccaaagctcaacccaaagaaatgctgccaatcgtagacaaaccgaccattcagtac
atcattgaagaagcggttcaatccggtattgaagatgtcattattgtcacaggaagaaac
aaaagagccattgaggatcattttgaccgttctgtagaacttgaactatttctaaaaaac
ggagaaaagtccgaattgctcgatatggtcaaacatattgctgagatggtcgatatccat
tatgtccgccaaaaagaagctctggggcttggtcatgccgtatacagtgccagaagattt
attggcaatgagccgtttgccgttcttttgggagacgatgtgatctattcggatgagcct
tgtctgaaacaaatgattaggtactacgagctgtataacagcaatctgattggcgtacag
gaagtactgccggcagaagtgtccaaatacgggattattgatggcagcagaatatctccg
agactgtacaaggcggaagccatgtttgaaaagccggccccggaggaagcgcctgatatt
ccgcttgcgatcatgggccggtatattcttaatccggaaatttttgatatcctcgcggaa
ttgcctccgggaagaaatggagaaattcagctaacggatgcaattgcgcagttgagcaag
gttcaggatgtgtatgcctacaattttgaagggaaaagatatgatgtcggggacaaactt
ggttttgtcagagcaaccattgaatttgcgttaagacatgaagaaattggcgaaagcctg
atggattatctgaccgatatcgtcagccggtatcagaaagaaggtcaggagcttcgcctg
ctttcagcaggcaataatttggacaaactttatgatattaagaagaattacagttaa

DBGET integrated database retrieval system