KEGG   Dehalobacter sp. CF: DCF50_p2823Help
Entry
DCF50_p2823       CDS       T02279                                 

Definition
carboxylesterase (est)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
dec  Dehalobacter sp. CF
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2919838..2920602)
Genome map
AA seq 254 aa AA seqDB search
MFTREELIKPFYFSGGSTAILLIHGFTACPIDMKPLGERLKNWGYTVQAPLLPGHGTSIE
DLKKTSWQDWERAVAEAAEQLKKTCQRVLAIGHSMGGLLALSLAAQGRIDGAVSINAPII
YVDEKLHQAESLIGKIEYVGKPHKTAEISLNSEGLPHFSYIQVPVISFISLNQAIERMKG
KLPQISCPTLMVQSMADGTVHPSSGEFIQKSIGDRYCDAVYWKDEDHYLPLSAARDELAQ
KIREFIEKRQLLVP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtttacacgagaagagctgatcaaacctttttacttttcaggcggaagcacggcgatc
cttctgattcacggctttacagcctgcccgattgatatgaagccacttggcgagagattg
aaaaattggggatatacagtccaggccccgcttctgcccggccatggaacttcaatagaa
gacttgaagaagacatcctggcaggattgggagcgagctgttgccgaagcagctgagcaa
ttaaagaaaacgtgtcagagagtccttgccattggacattccatgggcggattgctggca
ctatctctggcagctcagggcaggatcgacggtgcagtctccatcaatgccccgattatt
tatgttgatgaaaagctgcatcaggccgaaagcttgataggaaaaatagaatatgttggc
aagccgcataaaaccgctgagatcagcctgaacagcgagggactcccacatttttcctat
attcaggtaccggtaatatcatttatttccttaaaccaagccattgaacgaatgaaagga
aagttgccccaaattagctgtccgacgcttatggtccagagcatggctgacgggacagtc
catccgtccagcggcgaatttattcagaagagcatcggagaccgttattgcgatgcagtt
tactggaaagatgaggaccactatctgccgttgagcgcagcgcgggacgaattggcccaa
aaaatacgggaatttatagaaaagcgtcagctgctggtcccatag

DBGET integrated database retrieval system