KEGG   Dehalobacter sp. CF: DCF50_p2828Help
Entry
DCF50_p2828       CDS       T02279                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dec  Dehalobacter sp. CF
Pathway
dec00010  Glycolysis / Gluconeogenesis
dec00051  Fructose and mannose metabolism
dec00562  Inositol phosphate metabolism
dec01100  Metabolic pathways
dec01110  Biosynthesis of secondary metabolites
dec01120  Microbial metabolism in diverse environments
dec01130  Biosynthesis of antibiotics
dec01200  Carbon metabolism
dec01230  Biosynthesis of amino acids
Module
dec_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DCF50_p2828
   00051 Fructose and mannose metabolism
    DCF50_p2828
   00562 Inositol phosphate metabolism
    DCF50_p2828
Enzymes [BR:dec01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DCF50_p2828
Exosome [BR:dec04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DCF50_p2828
  Exosomal proteins of bladder cancer cells
   DCF50_p2828
  Exosomal proteins of melanoma cells
   DCF50_p2828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-ProteinID: AFV06831
UniProt: K4L891
Position
complement(2926364..2927128)
Genome map
AA seq 254 aa AA seqDB search
MTRKPIIAGNWKMYKTVQEAKDFAAGLLENLEKLENGTNAEMVICAPFTALAALKDELEE
SIIHIGAQNMYYETQGAYTGEISPLMLTELACTYVIIGHSERREYFKEDDALIARKVKTA
LDFGLTPILCVGENLALREAGQALVFVQGQVENALRELSPEAIRKIVVAYEPIWAIGTGR
TASPQDAQEMCAAIRTTLARLSAEAAQEIRILYGGSVKASNIAELMDQPDIDGALVGGAS
LDFLGFTELIGSVR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaaagccgatcattgcaggtaattggaagatgtataagacggtacaggaagcc
aaagattttgccgcgggactgttggaaaatttggagaaactggaaaatggaacaaacgcg
gaaatggtaatttgtgcaccgtttactgcgctggctgccttaaaggatgaacttgaagag
agtatcatccatattggcgcccaaaatatgtattatgagacacaaggcgcgtataccgga
gagatatcgccgcttatgctgacagagctagcctgtacctatgtgattatcggccactcg
gaacgcagggaatattttaaagaagatgacgcgcttatagcaagaaaagttaagaccgca
ctggactttggactgacgccaattctgtgtgtcggtgagaacttggctttgagagaagca
ggtcaggccctagtctttgtgcaagggcaggttgagaatgccctcagggagttgagtcct
gaagcaatcagaaagattgttgttgcatatgaacccatttgggctatcggaacaggcagg
acagcctctccgcaggatgcccaggaaatgtgtgccgcaatccgtaccaccctggcgagg
ctctccgctgaagccgctcaggaaatacgaattttatacggtggaagtgtcaaggcttcc
aatatcgccgaactgatggatcagccggatattgatggtgcgctggtcggtggagcaagt
ctggacttccttggatttactgaactgattggcagcgtgaggtga

DBGET integrated database retrieval system