KEGG   Dehalobacter sp. CF: DCF50_p2828Help
Entry
DCF50_p2828       CDS       T02279                                 

Definition
Triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dec  Dehalobacter sp. CF
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:dec01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dec01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dec00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dec00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dec00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2926364..2927128)
Genome map
AA seq 254 aa AA seqDB search
MTRKPIIAGNWKMYKTVQEAKDFAAGLLENLEKLENGTNAEMVICAPFTALAALKDELEE
SIIHIGAQNMYYETQGAYTGEISPLMLTELACTYVIIGHSERREYFKEDDALIARKVKTA
LDFGLTPILCVGENLALREAGQALVFVQGQVENALRELSPEAIRKIVVAYEPIWAIGTGR
TASPQDAQEMCAAIRTTLARLSAEAAQEIRILYGGSVKASNIAELMDQPDIDGALVGGAS
LDFLGFTELIGSVR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaaagccgatcattgcaggtaattggaagatgtataagacggtacaggaagcc
aaagattttgccgcgggactgttggaaaatttggagaaactggaaaatggaacaaacgcg
gaaatggtaatttgtgcaccgtttactgcgctggctgccttaaaggatgaacttgaagag
agtatcatccatattggcgcccaaaatatgtattatgagacacaaggcgcgtataccgga
gagatatcgccgcttatgctgacagagctagcctgtacctatgtgattatcggccactcg
gaacgcagggaatattttaaagaagatgacgcgcttatagcaagaaaagttaagaccgca
ctggactttggactgacgccaattctgtgtgtcggtgagaacttggctttgagagaagca
ggtcaggccctagtctttgtgcaagggcaggttgagaatgccctcagggagttgagtcct
gaagcaatcagaaagattgttgttgcatatgaacccatttgggctatcggaacaggcagg
acagcctctccgcaggatgcccaggaaatgtgtgccgcaatccgtaccaccctggcgagg
ctctccgctgaagccgctcaggaaatacgaattttatacggtggaagtgtcaaggcttcc
aatatcgccgaactgatggatcagccggatattgatggtgcgctggtcggtggagcaagt
ctggacttccttggatttactgaactgattggcagcgtgaggtga

DBGET integrated database retrieval system