KEGG   Dehalobacter sp. CF: DCF50_p343Help
Entry
DCF50_p343        CDS       T02279                                 

Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dec  Dehalobacter sp. CF
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DCF50_p343
Enzymes [BR:dec01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     DCF50_p343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
354330..355553
Genome map
AA seq 407 aa AA seqDB search
MKDLKAYNMRWLKIDSLLQAEKALSQVGVDLGVLQHMNGKALTKPIKLENVPAPVALILK
QEMLSFGGDAAVHKDLLDSGAPESDVLLLGNYKQLTRLADKLSSMSPECQYLAESLHEML
VYLDIPPAGVIDCRGKILEWGKKTLIMGILNVTPDSFSDGGKFDNIENALKQAEKMVADG
ADMLDIGGESTRPGYGGVSAEEEWSRLEPVLKALIPVCSVPISIDTQKAAVAAKSLRLGA
HIINDIWGLQKDPEMARVIAEYQAPIVIMHNQDHTEYKNMMGEILSFLERSIEMALDCGL
TQNQIIVDPGIGFGKTPEQNMEVLSRMEEFKSLGCPLLLGVSRKSVIGRTLNLPVDQRLE
PTIALGTLGIVAGADILRVHDVPENKKAALITDLVIRRKRGEDYEGK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggatttgaaggcgtacaatatgcgatggctcaaaatagatagcctactgcaggcc
gaaaaagctctcagccaggttggcgttgaccttggcgtccttcaacatatgaatggcaag
gctttgaccaaaccgatcaagctggagaatgtgccagctccggtggcattgattctgaaa
caggaaatgctctccttcggtggggatgcagctgtccataaagatttgctcgacagtgga
gcaccggaaagcgatgtattacttcttggtaactataagcagttaaccagactagcggat
aaacttagctcaatgtcgccagagtgccagtatcttgccgagtccctccatgaaatgttg
gtctatttagatatacctccggccggcgtgatcgattgcaggggaaaaattcttgagtgg
ggaaaaaagaccctgatcatgggaatcctgaatgttacaccggattctttttccgacggc
ggaaaatttgataacatcgagaatgctttaaaacaggccgaaaaaatggttgccgacggt
gctgatatgcttgatattggcggagagtccacccgcccgggatatgggggcgtcagtgcc
gaagaagagtggtccagacttgaaccggtacttaaagcacttatcccggtctgttcggtt
ccaatatcgattgatacccaaaaagcagctgttgcagccaagtctttgcggttgggggcc
catatcattaatgatatctggggtttgcagaaagatcctgaaatggcccgcgttattgca
gaatatcaagctccgatcgtgataatgcataatcaggatcatacagaatataagaatatg
atgggtgaaatattgtcattcctggagcgtagcattgaaatggctctagattgcggattg
acgcagaatcaaattattgtcgatcccggaatcgggtttggaaaaacaccggaacagaat
atggaagtcttaagccggatggaagaatttaaatcgctagggtgtcctcttcttctggga
gtatcccgcaaatccgtgattggacggaccttgaaccttccggttgatcaaaggctcgaa
ccgacgattgccctggggacgctcggaattgttgccggagcagatattctgcgtgtgcat
gatgttcccgaaaacaaaaaggctgcgcttatcactgacctggtgatacgtcgaaaaaga
ggagaagattatgaaggaaagtga

DBGET integrated database retrieval system