KEGG   Dehalobacter sp. CF: DCF50_p432Help
Entry
DCF50_p432        CDS       T02279                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dec  Dehalobacter sp. CF
Pathway
dec00260  Glycine, serine and threonine metabolism
dec00750  Vitamin B6 metabolism
dec01100  Metabolic pathways
dec01110  Biosynthesis of secondary metabolites
dec01120  Microbial metabolism in diverse environments
dec01230  Biosynthesis of amino acids
Module
dec_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DCF50_p432
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DCF50_p432
Enzymes [BR:dec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DCF50_p432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AFV04438
UniProt: K4LD83
Position
449892..451373
Genome map
AA seq 493 aa AA seqDB search
MYLSTRGNIDAQTSAQAIALGMVPQGGLFVPQEIPCVDWKQYANCSYAELALQIMKLYCG
DLPAGTLEEAVKVYGDGRFDTSNPAPLVEVDGCGMLELWHGPTAAFKDMALQVLPYLLTA
SIKELGLDVEVLILTATSGDTGKAALDGFKDVPGTRIVVFYPDGGVSAVQERQMVTTGGG
NTFVVAINGNFDECQTAVKKIFSSEELRQKLNASHMVFSSANSINWGRLLPQIVYYFWAY
LEAVRLGKTAAEEKINIVVPTGNFGNILAAYYAKRMGLPLGRLICASNKNNVLTDFFTAG
TYESNRPFYLTSSPSMDILISSNFERFLFEVSGRDAGKISSWFKRLSSEGKFSADPDTLT
ACRENMIAGWTDEEGVFETIKKVYEEDNYLLDPHTAVAMKVYNDYRENSGDKTFTVLTST
ASPFKFAQSVLTAIAGDRYRECDPWEALTRLSALTGWDIPSGLQGLREKSAQEVYRCQPE
EITAYLERKFLKD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtatcttagtacccgcggcaacattgatgctcagacctctgcccaggcgattgctcta
ggaatggtacctcagggaggactatttgttcctcaggagatcccctgcgtggattggaaa
caatatgccaactgcagttacgccgagcttgcgctgcaaattatgaagctgtattgcgga
gatctaccggcaggaacgctggaagaggcagttaaagtatacggagacggacgttttgat
acgtcaaaccccgcaccgcttgttgaagtcgacggctgcgggatgctggaactctggcac
ggcccgaccgctgcttttaaagatatggccctgcaggtgttgccttatctgcttactgca
agtattaaagaacttggacttgatgtggaagttctgattcttacggcgacttctggagat
accggcaaggccgccttggacggatttaaggatgttccgggtactcggattgtggttttt
tatcccgacggcggcgttagcgctgtgcaggaacgccagatggttacaacaggtggagga
aatactttcgttgtggcgatcaacggaaattttgacgagtgccagactgcagttaaaaag
attttttcatctgaagaactgcgccaaaaactgaatgccagccatatggttttctcctca
gcgaattccatcaactggggaagactgctgccgcagattgtttattatttctgggcctat
ctcgaggcagtaagactcggaaaaactgctgcggaagagaaaatcaacatcgtggttccc
acgggtaattttggcaatattctggcagcttattatgctaagagaatgggactgccactg
ggcaggctgatttgtgcatcgaataaaaacaatgtgcttacggacttcttcactgccgga
acttatgaaagcaatcgtccgttttatctgacttcgtcaccttcaatggacatccttatt
tccagcaattttgagcgctttttgtttgaagtatccggaagagatgccggcaagatcagt
agctggttcaaacgtctctccagcgaagggaagttcagtgcggatccggatactttgact
gcctgtagggagaatatgatcgctggctggacggatgaagagggtgttttcgaaaccatc
aaaaaagtgtatgaagaagacaactatctgctggacccgcatacggctgtcgcgatgaag
gtttacaacgattatcgagaaaacagcggggacaaaacctttactgtcctgacttcaacg
gcgagtcctttcaagtttgctcaaagcgtgctgacagcaattgccggtgacaggtacaga
gaatgtgacccctgggaagcgttgaccaggctcagcgctttgacgggctgggatatccct
tccgggctacagggtttaagagagaagtctgcccaggaggtataccggtgccagccggag
gaaattaccgcttatctggaaaggaaatttctcaaggactag

DBGET integrated database retrieval system