KEGG   Dehalobacter sp. CF: DCF50_p432Help
Entry
DCF50_p432        CDS       T02279                                 

Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dec  Dehalobacter sp. CF
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DCF50_p432
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DCF50_p432
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DCF50_p432
Enzymes [BR:dec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DCF50_p432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
449892..451373
Genome map
AA seq 493 aa AA seqDB search
MYLSTRGNIDAQTSAQAIALGMVPQGGLFVPQEIPCVDWKQYANCSYAELALQIMKLYCG
DLPAGTLEEAVKVYGDGRFDTSNPAPLVEVDGCGMLELWHGPTAAFKDMALQVLPYLLTA
SIKELGLDVEVLILTATSGDTGKAALDGFKDVPGTRIVVFYPDGGVSAVQERQMVTTGGG
NTFVVAINGNFDECQTAVKKIFSSEELRQKLNASHMVFSSANSINWGRLLPQIVYYFWAY
LEAVRLGKTAAEEKINIVVPTGNFGNILAAYYAKRMGLPLGRLICASNKNNVLTDFFTAG
TYESNRPFYLTSSPSMDILISSNFERFLFEVSGRDAGKISSWFKRLSSEGKFSADPDTLT
ACRENMIAGWTDEEGVFETIKKVYEEDNYLLDPHTAVAMKVYNDYRENSGDKTFTVLTST
ASPFKFAQSVLTAIAGDRYRECDPWEALTRLSALTGWDIPSGLQGLREKSAQEVYRCQPE
EITAYLERKFLKD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtatcttagtacccgcggcaacattgatgctcagacctctgcccaggcgattgctcta
ggaatggtacctcagggaggactatttgttcctcaggagatcccctgcgtggattggaaa
caatatgccaactgcagttacgccgagcttgcgctgcaaattatgaagctgtattgcgga
gatctaccggcaggaacgctggaagaggcagttaaagtatacggagacggacgttttgat
acgtcaaaccccgcaccgcttgttgaagtcgacggctgcgggatgctggaactctggcac
ggcccgaccgctgcttttaaagatatggccctgcaggtgttgccttatctgcttactgca
agtattaaagaacttggacttgatgtggaagttctgattcttacggcgacttctggagat
accggcaaggccgccttggacggatttaaggatgttccgggtactcggattgtggttttt
tatcccgacggcggcgttagcgctgtgcaggaacgccagatggttacaacaggtggagga
aatactttcgttgtggcgatcaacggaaattttgacgagtgccagactgcagttaaaaag
attttttcatctgaagaactgcgccaaaaactgaatgccagccatatggttttctcctca
gcgaattccatcaactggggaagactgctgccgcagattgtttattatttctgggcctat
ctcgaggcagtaagactcggaaaaactgctgcggaagagaaaatcaacatcgtggttccc
acgggtaattttggcaatattctggcagcttattatgctaagagaatgggactgccactg
ggcaggctgatttgtgcatcgaataaaaacaatgtgcttacggacttcttcactgccgga
acttatgaaagcaatcgtccgttttatctgacttcgtcaccttcaatggacatccttatt
tccagcaattttgagcgctttttgtttgaagtatccggaagagatgccggcaagatcagt
agctggttcaaacgtctctccagcgaagggaagttcagtgcggatccggatactttgact
gcctgtagggagaatatgatcgctggctggacggatgaagagggtgttttcgaaaccatc
aaaaaagtgtatgaagaagacaactatctgctggacccgcatacggctgtcgcgatgaag
gtttacaacgattatcgagaaaacagcggggacaaaacctttactgtcctgacttcaacg
gcgagtcctttcaagtttgctcaaagcgtgctgacagcaattgccggtgacaggtacaga
gaatgtgacccctgggaagcgttgaccaggctcagcgctttgacgggctgggatatccct
tccgggctacagggtttaagagagaagtctgcccaggaggtataccggtgccagccggag
gaaattaccgcttatctggaaaggaaatttctcaaggactag

DBGET integrated database retrieval system