KEGG   Dehalobacter sp. CF: DCF50_p583Help
Entry
DCF50_p583        CDS       T02279                                 

Definition
Tryptophan synthase beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dec  Dehalobacter sp. CF
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DCF50_p583
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DCF50_p583
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DCF50_p583
Enzymes [BR:dec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DCF50_p583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
589528..590781
Genome map
AA seq 417 aa AA seqDB search
MKNEMVNYLGENGYFGAYGGRFVPEILIPAVDELSLAFQEILRDEDFYKQYYNLLMDFSG
RPTPLTYAEGLSAYFGKAKIFIKREDLNHSGAHKINNVLGQGLLMKKLGKTRVIAETGAG
QHGVATAIMAAKMGFQATIYMGAEDAERQYANVFWMKQLGAEVIPVTTGTATLKDAINEA
LRDWAGNFDNTHYALGTACGPRPFPEMVTFFQSVISKEMKKQINDICGKNPDRIYACLGG
GSNAMGAFVEFLQEPGVELVAVEAGGKGEASGKHASRIAYAKAKTGVSQGYKTLFLQDDD
GQMLDTWSISAGLDYVGVSPILAHLAETKRVRVLAATDAEVIEAFKLIISKEGLIPALES
THAFAGLFREIADTKPEDVIVVNMSGRGDKDIFNIGEALQDQGWKTFVTERGKAYAD
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaatggttaactatcttggggaaaatggttattttggcgcctatggcggg
agatttgtcccggaaatcctgataccggctgtcgatgaactgagtctggcttttcaggaa
atattgcgggacgaggacttctataagcaatactataacctcctgatggacttttcgggc
aggccgacaccgctgacgtatgcggaagggcttagtgcctattttggtaaagccaaaatc
tttatcaagcgggaggatttgaatcattccggcgcccataaaatcaataatgtgctcggg
cagggcctgctcatgaaaaaactgggcaagaccagagtcatcgctgagaccggcgcaggc
cagcacggtgtggcaacggcgatcatggcggcgaaaatgggatttcaggcgacgatctat
atgggggctgaagacgctgaacggcaatatgccaatgtcttctggatgaaacagctcgga
gctgaagttattcctgtgacaaccgggacggcaacgcttaaggatgccattaacgaagcg
cttcgcgactgggcaggaaattttgataacacgcattatgcacttggcacggcgtgcgga
ccgaggccattcccggagatggtcactttctttcagtccgtaatcagtaaagagatgaaa
aaacaaatcaacgatatctgcggcaaaaatccagaccggatctatgcctgtctgggcggc
ggttccaatgcgatgggcgcttttgtggaattcctgcaggagcccggcgtagaacttgtt
gccgtcgaggcaggcggaaagggcgaagcttccggaaaacatgcttcgcggatcgcttat
gccaaagccaaaaccggcgtctctcagggctacaagacattgtttctccaggatgatgac
ggacagatgctggatacctggagcatttccgccggacttgattatgtaggcgtatcacca
atcctggctcatttggcggaaaccaagagggtccgggttttagccgccacagatgccgaa
gtcattgaggcctttaaactgatcatcagcaaggaagggctgataccggcgcttgaatcc
acgcatgctttcgccggacttttcagggaaattgctgacaccaaaccggaagatgtcatc
gttgtcaatatgtccggccgcggagacaaagatatcttcaacattggggaagcattgcag
gatcagggctggaaaacatttgtcacagaaagaggtaaggcatatgcagattga

DBGET integrated database retrieval system